Products

cDNA Clones (19)
Proteins (13)
Antibodies (2)
Jump to Filters
View as table Download
FBXO17 (NM_148169) Human Tagged ORF Clone
RC222996

USD 420.00

In Stock

FBXO17 (Myc-DDK-tagged)-Human F-box protein 17 (FBXO17), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
FBXO17 (NM_024907) Human Tagged ORF Clone
RC202158

USD 420.00

In Stock

FBXO17 (Myc-DDK-tagged)-Human F-box protein 17 (FBXO17), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
FBXO17 (NM_148169) Human Tagged ORF Clone Lentiviral Particle
RC222996L1V

USD 820.00

3 Weeks

Lenti ORF particles, FBXO17 (Myc-DDK tagged) - Human F-box protein 17 (FBXO17), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
FBXO17 (NM_148169) Human Tagged ORF Clone Lentiviral Particle
RC222996L2V

USD 820.00

6 Weeks

Lenti ORF particles, FBXO17 (mGFP-tagged) - Human F-box protein 17 (FBXO17), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
FBXO17 (NM_024907) Human Tagged ORF Clone
RG202158

USD 460.00

In Stock

FBXO17 (GFP-tagged) - Human F-box protein 17 (FBXO17), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FBXO17 (NM_024907) Human Tagged ORF Clone
RC202158L3

USD 620.00

3 Weeks

Lenti ORF clone of Human F-box protein 17 (FBXO17), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO17 (NM_024907) Human Tagged ORF Clone Lentiviral Particle
RC202158L3V

USD 820.00

6 Weeks

Lenti ORF particles, FBXO17 (Myc-DDK tagged) - Human F-box protein 17 (FBXO17), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO17 (NM_024907) Human Tagged ORF Clone
RC202158L4

USD 620.00

3 Weeks

Lenti ORF clone of Human F-box protein 17 (FBXO17), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO17 (NM_024907) Human Tagged ORF Clone Lentiviral Particle
RC202158L4V

USD 820.00

6 Weeks

Lenti ORF particles, FBXO17 (mGFP-tagged) - Human F-box protein 17 (FBXO17), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO17 (NM_148169) Human Tagged ORF Clone
RC222996L3

USD 620.00

3 Weeks

Lenti ORF clone of Human F-box protein 17 (FBXO17), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO17 (NM_148169) Human Tagged ORF Clone Lentiviral Particle
RC222996L3V

USD 820.00

7 Weeks

Lenti ORF particles, FBXO17 (Myc-DDK tagged) - Human F-box protein 17 (FBXO17), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO17 (NM_148169) Human Tagged ORF Clone
RC222996L4

USD 620.00

3 Weeks

Lenti ORF clone of Human F-box protein 17 (FBXO17), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO17 (NM_148169) Human Tagged ORF Clone Lentiviral Particle
RC222996L4V

USD 820.00

7 Weeks

Lenti ORF particles, FBXO17 (mGFP-tagged) - Human F-box protein 17 (FBXO17), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO17 (NM_148169) Human Tagged ORF Clone
RG222996

USD 460.00

3 Weeks

FBXO17 (GFP-tagged) - Human F-box protein 17 (FBXO17), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FBXO17 Rabbit Polyclonal Antibody
TA331636

USD 375.00

5 Days

Rabbit Polyclonal Anti-FBXO17 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FBXO17 Antibody is: synthetic peptide directed towards the N-terminal region of Human FBXO17. Synthetic peptide located within the following region: VQVLSHVPPRSLVTRCRPVCRAWRDIVDGPTVWLLQLARDRSAEGRALYA
FBXO17 (NM_148169) Human Tagged ORF Clone
RC222996L1

USD 768.00

In Stock

Lenti ORF clone of Human F-box protein 17 (FBXO17), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
FBXO17 Rabbit Polyclonal Antibody
TA309659

USD 350.00

2 Weeks

Rabbit Polyclonal FBG4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide contianing residues 70-85 (LQLARDRSAEGRALYA) of the human FBG4 protein. There is 100% sequence identity between the immunogen and mouse and rat sequences.
FBXO17 (NM_148169) Human Tagged ORF Clone
RC222996L2

USD 620.00

3 Weeks

Lenti ORF clone of Human F-box protein 17 (FBXO17), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
FBXO17 (NM_024907) Human Recombinant Protein
TP760528

USD 215.00

In Stock

Purified recombinant protein of Human F-box protein 17 (FBXO17), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
FBXO17 (NM_148169) Human Over-expression Lysate
LC407767

USD 121.00

In Stock

FBXO17 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FBXO17 (NM_024907) Human Untagged Clone
SC323757

USD 660.00

In Stock

FBXO17 (untagged)-Human F-box protein 17 (FBXO17), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
FBXO17 (NM_024907) Human Over-expression Lysate
LC411006

USD 121.00

2 Weeks

FBXO17 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FBXO17 (NM_148169) Human Over-expression Lysate
LC430185

USD 121.00

2 Weeks

FBXO17 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FBXO17 (NM_148169) Human Over-expression Lysate
LY407767

USD 396.00

5 Days

Transient overexpression lysate of F-box protein 17 (FBXO17), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY407767 is the same product as LY430185.
FBXO17 (NM_024907) Human Over-expression Lysate
LY411006

USD 396.00

5 Days

Transient overexpression lysate of F-box protein 17 (FBXO17), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FBXO17 (NM_148169) Human Over-expression Lysate
LY430185

USD 396.00

5 Days

Transient overexpression lysate of F-box protein 17 (FBXO17), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FBXO17 (NM_148169) Human Untagged Clone
SC310570

USD 660.00

3 Weeks

FBXO17 (untagged)-Human F-box protein 17 (FBXO17), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
FBXO17 (AK092197) Human Untagged Clone
SC312244

USD 960.00

3 Weeks

(untagged)-Human cDNA FLJ34878 fis, clone NT2NE2015565, weakly similar to RETROVIRUS-RELATED ENV POLYPROTEIN

Vector pCMV6 series
Tag Tag Free
FBXO17 (NM_024907) ICC Control Block
TB402158

USD 1,070.00

4 Weeks

Transient overexpression of FBXO17 (NM_024907) in HEK293T cells paraffin embedded controls for ICC/IHC staining

FBXO17 (NM_148169) ICC Control Block
TB422996

USD 1,070.00

4 Weeks

Transient overexpression of FBXO17 (NM_148169) in HEK293T cells paraffin embedded controls for ICC/IHC staining

FBXO17 Cytosection
TS402158

USD 225.00

4 Weeks

Transient overexpression of FBXO17 (NM_024907) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

FBXO17 Cytosection
TS402158P5

USD 889.00

4 Weeks

Transient overexpression of FBXO17 (NM_024907) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

FBXO17 Cytosection
TS422996

USD 225.00

4 Weeks

Transient overexpression of FBXO17 (NM_148169) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

FBXO17 Cytosection
TS422996P5

USD 889.00

4 Weeks

Transient overexpression of FBXO17 (NM_148169) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack