GABRR2 (Myc-DDK-tagged)-Human gamma-aminobutyric acid (GABA) receptor, rho 2 (GABRR2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
GABRR2 (Myc-DDK-tagged)-Human gamma-aminobutyric acid (GABA) receptor, rho 2 (GABRR2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GABRR2 (GFP-tagged) - Human gamma-aminobutyric acid (GABA) receptor, rho 2 (GABRR2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of GABRR2 (Myc-DDK-tagged)-Human gamma-aminobutyric acid (GABA) receptor, rho 2 (GABRR2)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GABRR2 (Myc-DDK-tagged)-Human gamma-aminobutyric acid (GABA) receptor, rho 2 (GABRR2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GABRR2 (mGFP-tagged)-Human gamma-aminobutyric acid (GABA) receptor, rho 2 (GABRR2)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GABRR2 (mGFP-tagged)-Human gamma-aminobutyric acid (GABA) receptor, rho 2 (GABRR2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GABRR2 (untagged)-Human gamma-aminobutyric acid (GABA) receptor, rho 2 (GABRR2)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GABRR2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRR2 antibody: synthetic peptide directed towards the middle region of human GABRR2. Synthetic peptide located within the following region: SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY |
GABRR2 (untagged)-Human gamma-aminobutyric acid (GABA) receptor, rho 2 (GABRR2)
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of GABRR2 (NM_002043) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GABRR2 (NM_002043) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GABRR2 (NM_002043) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack