Germany
Japan
United Kingdom
China
GANC (Myc-DDK-tagged)-Human glucosidase, alpha, neutral C (GANC)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti-ORF clone of GANC (Myc-DDK-tagged)-Human glucosidase, alpha; neutral C (GANC)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GANC (Myc-DDK-tagged)-Human glucosidase, alpha; neutral C (GANC), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GANC (mGFP-tagged)-Human glucosidase, alpha; neutral C (GANC)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GANC (mGFP-tagged)-Human glucosidase, alpha; neutral C (GANC), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GANC (myc-DDK-tagged) - Human glucosidase, alpha, neutral C (GANC), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GANC (myc-DDK-tagged) - Human glucosidase, alpha, neutral C (GANC), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GANC (GFP-tagged) - Human glucosidase, alpha; neutral C (GANC)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GANC (untagged)-Human glucosidase, alpha, neutral C (GANC)
| Vector | PCMV6-Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
(untagged)-Human mRNA for FLJ00088 protein
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GANC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GANC Antibody: synthetic peptide directed towards the middle region of human GANC. Synthetic peptide located within the following region: VLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLSLNIATDWEVR |
GANC (GFP-tagged) - Human glucosidase, alpha, neutral C (GANC), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GANC (GFP-tagged) - Human glucosidase, alpha, neutral C (GANC), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GANC (untagged) - Human glucosidase, alpha, neutral C (GANC), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
GANC (untagged) - Human glucosidase, alpha, neutral C (GANC), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of GANC (NM_198141) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GANC (NM_001301410) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GANC (NM_001301409) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GANC (NM_198141) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GANC (NM_198141) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GANC (NM_001301410) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GANC (NM_001301409) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GANC
Families
- Druggable Genome