GJB2 (Myc-DDK-tagged)-Human gap junction protein, beta 2, 26kDa (GJB2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GJB2 (Myc-DDK-tagged)-Human gap junction protein, beta 2, 26kDa (GJB2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GJB2 (untagged)-Human gap junction protein, beta 2, 26kDa (GJB2)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF particles, GJB2 (Myc-DDK tagged) - Human gap junction protein, beta 2, 26kDa (GJB2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, GJB2 (mGFP-tagged) - Human gap junction protein, beta 2, 26kDa (GJB2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
GJB2 (GFP-tagged) - Human gap junction protein, beta 2, 26kDa (GJB2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human gap junction protein, beta 2, 26kDa (GJB2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GJB2 (Myc-DDK tagged) - Human gap junction protein, beta 2, 26kDa (GJB2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human gap junction protein, beta 2, 26kDa (GJB2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GJB2 (mGFP-tagged) - Human gap junction protein, beta 2, 26kDa (GJB2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-Connexin 26 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Connexin 26 Antibody: A synthesized peptide derived from the extracellular region of human Connexin 26 |
Rabbit Polyclonal Anti-GJB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | GJB2 antibody was raised against a 16 amino acid peptide near the center of human GJB2. |
Lenti ORF clone of Human gap junction protein, beta 2, 26kDa (GJB2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human gap junction protein, beta 2, 26kDa (GJB2), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
GJB2 rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide mapping at the middle region of rat Connexin 26 |
GJB2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal Anti-GJB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GJB2 antibody: synthetic peptide directed towards the N terminal of human GJB2. Synthetic peptide located within the following region: STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW |
Transient overexpression lysate of gap junction protein, beta 2, 26kDa (GJB2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Anti-GJB2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 212-227 amino acids of Human gap junction protein, beta 2, 26kDa |
Transient overexpression of GJB2 (NM_004004) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GJB2 (NM_004004) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GJB2 (NM_004004) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack