Products

cDNA Clones (22)
Proteins (18)
Antibodies (3)
Jump to Filters
View as table Download
HPD (NM_002150) Human Tagged ORF Clone
RC206860

USD 420.00

In Stock

HPD (Myc-DDK-tagged)-Human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
HPD (NM_001171993) Human Tagged ORF Clone
RC229928

USD 420.00

In Stock

HPD (Myc-DDK-tagged)-Human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
HPD (NM_002150) Human Tagged ORF Clone Lentiviral Particle
RC206860L1V

USD 820.00

3 Weeks

Lenti ORF particles, HPD (Myc-DDK tagged) - Human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
HPD (NM_002150) Human Tagged ORF Clone Lentiviral Particle
RC206860L2V

USD 820.00

6 Weeks

Lenti ORF particles, HPD (mGFP-tagged) - Human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
HPD (NM_001171993) Human Tagged ORF Clone Lentiviral Particle
RC229928L1V

USD 820.00

6 Weeks

Lenti ORF particles, HPD (Myc-DDK tagged) - Human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
HPD (NM_001171993) Human Tagged ORF Clone Lentiviral Particle
RC229928L2V

USD 820.00

3 Weeks

Lenti ORF particles, HPD (mGFP-tagged) - Human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
HPD (NM_002150) Human Tagged ORF Clone
RG206860

USD 460.00

In Stock

HPD (GFP-tagged) - Human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HPD (NM_002150) Human Tagged ORF Clone
RC206860L3

USD 620.00

3 Weeks

Lenti ORF clone of Human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HPD (NM_002150) Human Tagged ORF Clone Lentiviral Particle
RC206860L3V

USD 820.00

5 Weeks

Lenti ORF particles, HPD (Myc-DDK tagged) - Human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HPD (NM_002150) Human Tagged ORF Clone
RC206860L4

USD 620.00

3 Weeks

Lenti ORF clone of Human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HPD (NM_002150) Human Tagged ORF Clone Lentiviral Particle
RC206860L4V

USD 820.00

7 Weeks

Lenti ORF particles, HPD (mGFP-tagged) - Human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HPD (NM_001171993) Human Tagged ORF Clone
RC229928L3

USD 620.00

3 Weeks

Lenti ORF clone of Human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HPD (NM_001171993) Human Tagged ORF Clone Lentiviral Particle
RC229928L3V

USD 820.00

7 Weeks

Lenti ORF particles, HPD (Myc-DDK tagged) - Human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HPD (NM_001171993) Human Tagged ORF Clone
RC229928L4

USD 620.00

3 Weeks

Lenti ORF clone of Human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HPD (NM_001171993) Human Tagged ORF Clone Lentiviral Particle
RC229928L4V

USD 820.00

5 Weeks

Lenti ORF particles, HPD (mGFP-tagged) - Human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HPD (NM_001171993) Human Tagged ORF Clone
RG229928

USD 460.00

3 Weeks

HPD (GFP-tagged) - Human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HPD (NM_001171993) Human Tagged Lenti ORF Clone
RC229928L2

USD 768.00

In Stock

Lenti ORF clone of Human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
HPD (NM_002150) Human Tagged ORF Clone
RC206860L1

USD 620.00

In Stock

Lenti ORF clone of Human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
HPD Rabbit Polyclonal Antibody
TA346087

USD 475.00

5 Days

Rabbit Polyclonal Anti-HPD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HPD antibody: synthetic peptide directed towards the middle region of human HPD. Synthetic peptide located within the following region: EMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIV
HPD (NM_002150) Human Tagged ORF Clone
RC206860L2

USD 620.00

3 Weeks

Lenti ORF clone of Human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
HPD (NM_001171993) Human Tagged ORF Clone
RC229928L1

USD 620.00

3 Weeks

Lenti ORF clone of Human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
HPD (NM_001171993) Human Over-expression Lysate
LC432928

USD 121.00

In Stock

HPD HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HPD (NM_002150) Human Untagged Clone
SC319575

USD 310.00

In Stock

HPD (untagged)-Human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
HPD (C-term) Rabbit Polyclonal Antibody
AP18053PU-N

USD 450.00

2 Weeks

HPD (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human HPD
HPD (N-term) Rabbit Polyclonal Antibody
AP18054PU-N

USD 450.00

2 Weeks

HPD (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human HPD
HPD (NM_002150) Human Over-expression Lysate
LY419503

USD 396.00

5 Days

Transient overexpression lysate of 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HPD / PPD (1-393, His-tag) Human Protein
AR09694PU-L

USD 1,105.00

2 Weeks

HPD / PPD (1-393, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
HPD / PPD (1-393, His-tag) Human Protein
AR09694PU-N

USD 415.00

2 Weeks

HPD / PPD (1-393, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
HPD (NM_002150) Human Over-expression Lysate
LC419503

USD 121.00

2 Weeks

HPD HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HPD (NM_001171993) Human Over-expression Lysate
LY432928

USD 396.00

5 Days

Transient overexpression lysate of 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HPD (NM_002150) Human Mass Spec Standard
PH306860

USD 2,055.00

3 Weeks

HPD MS Standard C13 and N15-labeled recombinant protein (NP_002141)

Tag C-Myc/DDK
Expression Host HEK293
HPD (NM_001171993) Human Untagged Clone
SC328566

USD 760.00

3 Weeks

HPD (untagged)-Human 4-hydroxyphenylpyruvate dioxygenase (HPD) transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
HPD ICC Control Block
TB406860

USD 1,070.00

4 Weeks

Transient overexpression of HPD (NM_002150) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HPD ICC Control Block
TB429928

USD 1,070.00

4 Weeks

Transient overexpression of HPD (NM_001171993) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HPD (NM_001171993) Human Recombinant Protein
TP720550

USD 330.00

3 Weeks

Recombinant protein of human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2.

Tag N-His
Expression Host E. coli
HPD (NM_001171993) Human Recombinant Protein
TP720550L

USD 1,900.00

3 Weeks

Recombinant protein of human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2.

Tag N-His
Expression Host E. coli
HPD (NM_001171993) Human Recombinant Protein
TP720550M

USD 760.00

3 Weeks

Recombinant protein of human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2.

Tag N-His
Expression Host E. coli
HPD (NM_001171993) Human Recombinant Protein
TP720550XL

USD 2,800.00

3 Weeks

Recombinant protein of human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2.

Tag N-His
Expression Host E. coli
HPD Cytosection
TS406860

USD 225.00

4 Weeks

Transient overexpression of HPD (NM_002150) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

HPD Cytosection
TS406860P5

USD 889.00

4 Weeks

Transient overexpression of HPD (NM_002150) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

HPD Cytosection
TS429928

USD 225.00

4 Weeks

Transient overexpression of HPD (NM_001171993) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

HPD Cytosection
TS429928P5

USD 889.00

4 Weeks

Transient overexpression of HPD (NM_001171993) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack