Germany
Japan
United Kingdom
China
IL1RL1 (Myc-DDK-tagged)-Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
IL1RL1 (Myc-DDK-tagged)-Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, IL1RL1 (Myc-DDK tagged) - Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, IL1RL1 (mGFP-tagged) - Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, IL1RL1 (Myc-DDK tagged) - Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, IL1RL1 (mGFP-tagged) - Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
IL1RL1 (GFP-tagged) - Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL1RL1 (GFP-tagged) - Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, IL1RL1 (Myc-DDK tagged) - Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IL1RL1 (Myc-DDK tagged) - Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IL1RL1 (mGFP-tagged) - Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IL1RL1 (mGFP-tagged) - Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
IL1RL1 (myc-DDK-tagged) - Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL1RL1 (untagged)-Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
IL1RL1 (untagged)-Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of interleukin 1 receptor-like 1 (IL1RL1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Purified recombinant protein of Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 1, esidues 19-328aa,secretory expressed with N-terminal HIS tag, expressed in HEK293, 50ug
| Tag | N-His |
| Expression Host | HEK293 |
IL1RL1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal ST2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | ST2 antibody was raised against a synthetic peptide corresponding to 16 amino acids at the amino-terminus of mouse ST2. This peptide is common to all three known ST2 isoforms. |
Rabbit Polyclonal Anti-IL1RL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL1RL1 antibody: synthetic peptide directed towards the N terminal of human IL1RL1. Synthetic peptide located within the following region: RQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTC |
Purified recombinant protein of Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 2
| Tag | C-DDK/His |
| Expression Host | HEK293 |
Purified recombinant protein of Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 1, esidues 19-328aa, with C-terminal DDK tag, secretory expressed in CHO cells, 50ug
| Tag | C-DDK |
| Expression Host | CHO |
Rabbit Polyclonal IL1RL1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 207-238 of human ST2V was used as immunogen, GenBank no BAA85894. |
Carrier-free (BSA/glycerol-free) ST2 mouse monoclonal antibody, clone OTI1B5B8
Carrier-free (BSA/glycerol-free) ST2 mouse monoclonal antibody, clone OTI1H4C4
Carrier-free (BSA/glycerol-free) ST2 mouse monoclonal antibody, clone OTI1H5
Carrier-free (BSA/glycerol-free) ST2 mouse monoclonal antibody, clone OTI1H1
Carrier-free (BSA/glycerol-free) ST2 mouse monoclonal antibody, clone OTI2F1
Carrier-free (BSA/glycerol-free) ST2 mouse monoclonal antibody, clone OTI1E4
Carrier-free (BSA/glycerol-free) ST2 mouse monoclonal antibody, clone OTI1E1
Carrier-free (BSA/glycerol-free) ST2 mouse monoclonal antibody, clone OTI3C12B4
Carrier-free (BSA/glycerol-free) ST2 mouse monoclonal antibody, clone OTI6E12
Carrier-free (BSA/glycerol-free) ST2 mouse monoclonal antibody, clone OTI7E5
Carrier-free (BSA/glycerol-free) ST2 mouse monoclonal antibody, clone OTI5E10
Carrier-free (BSA/glycerol-free) ST2 mouse monoclonal antibody, clone OTI15A3
Carrier-free (BSA/glycerol-free) ST2 mouse monoclonal antibody, clone OTI16A7
Carrier-free (BSA/glycerol-free) ST2 mouse monoclonal antibody, clone OTI17D12
Carrier-free (BSA/glycerol-free) ST2 mouse monoclonal antibody, clone OTI2C1
Carrier-free (BSA/glycerol-free) ST2 mouse monoclonal antibody, clone OTI12C9
Carrier-free (BSA/glycerol-free) ST2 mouse monoclonal antibody, clone OTI2G2
Carrier-free (BSA/glycerol-free) ST2 mouse monoclonal antibody, clone OTI8G3
Carrier-free (BSA/glycerol-free) ST2 mouse monoclonal antibody, clone OTI2B4
Carrier-free (BSA/glycerol-free) ST2 mouse monoclonal antibody, clone OTI3C10
Carrier-free (BSA/glycerol-free) ST2 mouse monoclonal antibody, clone OTI1F2A8
Active filters
Target Symbol
- IL1RL1
Families
- Druggable Genome