Germany
Japan
United Kingdom
China
NCR1 (Myc-DDK-tagged)-Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, NCR1 (Myc-DDK tagged) - Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, NCR1 (mGFP-tagged) - Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, NCR1 (Myc-DDK-tagged)-Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, NCR1 (mGFP-tagged)-Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, NCR1 (Myc-DDK-tagged)-Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, NCR1 (mGFP-tagged)-Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
NCR1 (Myc-DDK-tagged)-Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NCR1 (Myc-DDK-tagged)-Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NCR1 (GFP-tagged) - Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NCR1 (Myc-DDK tagged) - Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NCR1 (mGFP-tagged) - Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NCR1 (Myc-DDK-tagged)-Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NCR1 (Myc-DDK-tagged)-Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NCR1 (mGFP-tagged)-Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NCR1 (mGFP-tagged)-Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NCR1 (Myc-DDK-tagged)-Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 3
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NCR1 (Myc-DDK-tagged)-Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NCR1 (mGFP-tagged)-Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 3
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NCR1 (mGFP-tagged)-Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NCR1 (Myc-DDK tagged) - Homo sapiens natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NCR1 (Myc-DDK tagged) - Homo sapiens natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NCR1 (GFP-tagged) - Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NCR1 (GFP-tagged) - Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NCR1 (GFP-tagged) - Homo sapiens natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NCR1 (GFP-tagged) - Homo sapiens natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of NCR1 (Myc-DDK-tagged)-Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 2
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of NCR1 (Myc-DDK-tagged)-Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 3
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
NCR1 (untagged)-Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
NCR1 mouse monoclonal antibody, clone B-L46, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
Lenti ORF clone of Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of NCR1 (mGFP-tagged)-Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 2
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of NCR1 (mGFP-tagged)-Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 3
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-Gps2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Gps2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Gps2. Synthetic peptide located within the following region: LKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLNMQGSPGGHN |
NCR1 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
NCR1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-NCR1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NCR1. |
NCR1 mouse monoclonal antibody, clone B-N40, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
NCR1 mouse monoclonal antibody, clone B-N40, Azide Free
| Applications | FC |
| Reactivities | Human |
NCR1 mouse monoclonal antibody, clone B-N40, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
NCR1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NCR1 MS Standard C13 and N15-labeled recombinant protein (NP_001138930)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
CD335 / NKp46 (22-255) human protein, 0.1 mg
| Expression Host | E. coli |
CD335 / NKp46 (22-255) human protein, 0.5 mg
| Expression Host | E. coli |
NCR1 (untagged)-Human natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 2, mRNA
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Active filters
Target Symbol
- NCR1
Families
- Druggable Genome