Products

cDNA Clones (11)
Antibodies (6)
Proteins (5)
Jump to Filters
View as table Download
NMBR (NM_002511) Human Tagged ORF Clone
RC213319

USD 420.00

In Stock

NMBR (Myc-DDK-tagged)-Human neuromedin B receptor (NMBR)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NMBR (NM_002511) Human Tagged ORF Clone
RG213319

USD 460.00

In Stock

NMBR (GFP-tagged) - Human neuromedin B receptor (NMBR)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NMBR (NM_002511) Human Tagged ORF Clone Lentiviral Particle
RC213319L2V

USD 820.00

6 Weeks

Lenti ORF particles, NMBR (mGFP-tagged) - Human neuromedin B receptor (NMBR), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
NMBR (NM_002511) Human Tagged ORF Clone
RC213319L1

USD 768.00

In Stock

Lenti ORF clone of Human neuromedin B receptor (NMBR), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
NMBR (NM_002511) Human Tagged ORF Clone
RC213319L4

USD 768.00

In Stock

Lenti ORF clone of Human neuromedin B receptor (NMBR), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NMBR (NM_002511) Human Untagged Clone
SC118568

USD 670.00

In Stock

NMBR (untagged)-Human neuromedin B receptor (NMBR)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
NMBR (NM_002511) Human Over-expression Lysate
LY400899

USD 396.00

In Stock

Transient overexpression lysate of neuromedin B receptor (NMBR)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NMBR Rabbit Polyclonal Antibody
TA314264

USD 345.00

In Stock

Rabbit polyclonal anti-NMBR antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NMBR.
NMBR Rabbit Polyclonal Antibody
TA344313

USD 475.00

5 Days

Rabbit Polyclonal Anti-NMBR Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NMBR antibody: synthetic peptide directed towards the N terminal of human NMBR. Synthetic peptide located within the following region: PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL
NMBR (NM_002511) Human Tagged ORF Clone
RC213319L2

USD 620.00

3 Weeks

Lenti ORF clone of Human neuromedin B receptor (NMBR), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
NMBR Rabbit Polyclonal Antibody
TA328625

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-Bombesin Receptor 1

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KSAHNLPGEYNEHTKK, corresponding to amino acid residues 241-256 of human BB1.3rd intracellular loop.
NMBR Rabbit Polyclonal Antibody
TA340753

USD 425.00

2 Weeks

Rabbit Polyclonal Anti-NMBR Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen NMBR antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human NMBR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Panda, Bovine, Bat, Horse, Rabbit, Pig (100%); Marmoset, Rat, Hamster, Dog, Opossum (94%); Platypus (88%); Elephant, Xenopus (81%).
NMBR (NM_002511) Human Over-expression Lysate
LC400899

USD 121.00

In Stock

NMBR HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
NMBR (N-term) Rabbit Polyclonal Antibody
AP52896PU-N

USD 450.00

2 Weeks

NMBR (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 1-30aa) of human Neuromedin B receptor
NMBR Rabbit Polyclonal Antibody
TA341019

USD 425.00

5 Days

Rabbit Polyclonal Anti-NMBR Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen NMBR antibody was raised against synthetic 19 amino acid peptide from C-terminus of human NMBR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Mouse, Elephant, Bovine (89%); Rat, Panda, Dog, Bat, Rabbit, Pig, Platypus (84%).
NMBR ICC Control Block
TB413319

USD 1,070.00

4 Weeks

Transient overexpression of NMBR (NM_002511) in HEK293T cells paraffin embedded controls for ICC/IHC staining

NMBR Cytosection
TS413319

USD 225.00

4 Weeks

Transient overexpression of NMBR (NM_002511) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

NMBR Cytosection
TS413319P5

USD 889.00

4 Weeks

Transient overexpression of NMBR (NM_002511) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack