Germany
Japan
United Kingdom
China
NPTN (Myc-DDK-tagged)-Human neuroplastin (NPTN), transcript variant a
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
NPTN (Myc-DDK-tagged)-Human neuroplastin (NPTN), transcript variant d
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
NPTN (Myc-DDK-tagged)-Human neuroplastin (NPTN), transcript variant c
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human neuroplastin (NPTN), transcript variant alpha
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, NPTN (Myc-DDK tagged) - Human neuroplastin (NPTN), transcript variant a, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, NPTN (mGFP-tagged) - Human neuroplastin (NPTN), transcript variant a, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, NPTN (Myc-DDK-tagged)-Human neuroplastin (NPTN), transcript variant b, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, NPTN (mGFP-tagged)-Human neuroplastin (NPTN), transcript variant b, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
NPTN (Myc-DDK-tagged)-Human neuroplastin (NPTN), transcript variant b
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NPTN (GFP-tagged) - Human neuroplastin (NPTN), transcript variant a
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human neuroplastin (NPTN), transcript variant a, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NPTN (Myc-DDK tagged) - Human neuroplastin (NPTN), transcript variant a, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human neuroplastin (NPTN), transcript variant a, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NPTN (mGFP-tagged) - Human neuroplastin (NPTN), transcript variant a, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NPTN (Myc-DDK-tagged)-Human neuroplastin (NPTN), transcript variant b
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NPTN (Myc-DDK-tagged)-Human neuroplastin (NPTN), transcript variant b, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NPTN (mGFP-tagged)-Human neuroplastin (NPTN), transcript variant b
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NPTN (mGFP-tagged)-Human neuroplastin (NPTN), transcript variant b, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human neuroplastin (NPTN), transcript variant d, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NPTN (Myc-DDK tagged) - Human neuroplastin (NPTN), transcript variant d, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human neuroplastin (NPTN), transcript variant d, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NPTN (mGFP-tagged) - Human neuroplastin (NPTN), transcript variant d, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human neuroplastin (NPTN), transcript variant c, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NPTN (Myc-DDK tagged) - Human neuroplastin (NPTN), transcript variant c, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human neuroplastin (NPTN), transcript variant c, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NPTN (mGFP-tagged) - Human neuroplastin (NPTN), transcript variant c, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NPTN (GFP-tagged) - Human neuroplastin (NPTN), transcript variant b
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NPTN (GFP-tagged) - Human neuroplastin (NPTN), transcript variant d
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NPTN (GFP-tagged) - Human neuroplastin (NPTN), transcript variant c
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human neuroplastin (NPTN), transcript variant a, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of NPTN (Myc-DDK-tagged)-Human neuroplastin (NPTN), transcript variant b
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human neuroplastin (NPTN), transcript variant a, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of NPTN (mGFP-tagged)-Human neuroplastin (NPTN), transcript variant b
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
NPTN (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 79-108 amino acids from the N-terminal region of human NPTN |
NPTN HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of neuroplastin (NPTN), transcript variant a
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NPTN (untagged)-Human neuroplastin (NPTN), transcript variant a
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SC322063 is the updated version of SC114116.
Rabbit Polyclonal Anti-NPTN Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPTN antibody: synthetic peptide directed towards the middle region of human NPTN. Synthetic peptide located within the following region: MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN |
Rabbit polyclonal anti-NPTN antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NPTN. |
Rabbit Polyclonal Anti-NPTN Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | NPTN / SDR1 antibody was raised against synthetic 19 amino acid peptide from internal region of human NPTN. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig, Guinea pig (100%); Opossum, Turkey, Zebra finch, Chicken, Platypus, Lizard (89%); Salmon, Stickleback, Pufferfish (84%). |
Rabbit Polyclonal Anti-NPTN Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | NPTN / SDR1 antibody was raised against synthetic 16 amino acid peptide from N-terminus of human NPTN. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Rabbit (100%); Rat, Panda, Opossum (94%); Mouse, Bat, Dog, Bovine, Elephant, Pig (88%); Horse (81%). |
Rabbit Polyclonal Anti-NPTN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPTN antibody: synthetic peptide directed towards the middle region of human NPTN. Synthetic peptide located within the following region: SAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRK |
NPTN HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NPTN HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Active filters
Target Symbol
- NPTN
Families
- Druggable Genome