Products

View as table Download

NTRK3 (Myc-DDK-tagged)-Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

NTRK3 (Myc-DDK-tagged)-Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

NTRK3 (Myc-DDK-tagged)-Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, NTRK3 (mGFP-tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, NTRK3 (Myc-DDK tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, NTRK3 (mGFP-tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, NTRK3 (Myc-DDK tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, NTRK3 (mGFP-tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

NTRK3 (GFP-tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

NTRK3 (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens neurotrophic tyrosine kinase, receptor, type 3, transcript variant 1, Signal peptide (1-31) plus EC domain (32-429)

Vector pCMV6-XL5-DDK-His
Tag DDK-His
Mammalian Cell Selection None
  • TrueORF®

NTRK3 (GFP-tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

NTRK3 (GFP-tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NTRK3 (Myc-DDK tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NTRK3 (mGFP-tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NTRK3 (Myc-DDK tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NTRK3 (mGFP-tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NTRK3 (Myc-DDK tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NTRK3 (mGFP-tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

NTRK3 (Myc-DDK tagged) - Homo sapiens neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

NTRK3 (GFP-tagged) - Homo sapiens neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

NTRK3 (untagged)-Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

NTRK3 (untagged)-Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal TrkC Antibody

Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the extracellular domain of the human TrkC protein (within residues 300-400). [UniProt Q16288].

Rabbit anti-NTRK3 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NTRK3

Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

NTRK3 (untagged)-Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

NTRK3 (untagged)-Kinase deficient mutant (K572M) of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

NTRK3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

NTRK3 (untagged)-Human neurotrophic tyrosine kinase, receptor, type 3, transcript variant 3 (cDNA clone MGC:17113 IMAGE:4181574), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

NTRK3 (untagged)-Kinase deficient mutant (K572M) of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Recombinant protein of human mitotic spindle organizing protein 2A (MZT2A), residues 32-429aa, with C-terminal DDK tag, expressed in sf9, 20ug

Tag C-DDK
Expression Host Sf9

Rabbit polyclonal TrkC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TrkC antibody is generated from rabbits immunized with a his tag recombinant protein of human TrkC.

Rabbit Polyclonal Anti-NTRK3

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-NTRK3 antibody: synthetic peptide directed towards the C terminal of human NTRK3. Synthetic peptide located within the following region: ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG

Carrier-free (BSA/glycerol-free) NTRK3 mouse monoclonal antibody, clone OTI24B3 (formerly 24B3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NTRK3 mouse monoclonal antibody, clone OTI2B8 (formerly 2B8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NTRK3 mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated