NTRK3 (Myc-DDK-tagged)-Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
NTRK3 (Myc-DDK-tagged)-Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
NTRK3 (Myc-DDK-tagged)-Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
NTRK3 (Myc-DDK-tagged)-Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 970.00
3 Weeks
Lenti ORF particles, NTRK3 (Myc-DDK tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 970.00
6 Weeks
Lenti ORF particles, NTRK3 (mGFP-tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 1,310.00
3 Weeks
Lenti ORF particles, NTRK3 (Myc-DDK tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,310.00
6 Weeks
Lenti ORF particles, NTRK3 (mGFP-tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 1,330.00
3 Weeks
Lenti ORF particles, NTRK3 (Myc-DDK tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,330.00
6 Weeks
Lenti ORF particles, NTRK3 (mGFP-tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
NTRK3 (GFP-tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
NTRK3 (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens neurotrophic tyrosine kinase, receptor, type 3, transcript variant 1, Signal peptide (1-31) plus EC domain (32-429)
Vector | pCMV6-XL5-DDK-His |
Tag | DDK-His |
Mammalian Cell Selection | None |
NTRK3 (GFP-tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
NTRK3 (GFP-tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 970.00
5 Weeks
Lenti ORF particles, NTRK3 (Myc-DDK tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 970.00
7 Weeks
Lenti ORF particles, NTRK3 (mGFP-tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,310.00
5 Weeks
Lenti ORF particles, NTRK3 (Myc-DDK tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,310.00
7 Weeks
Lenti ORF particles, NTRK3 (mGFP-tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,330.00
3 Weeks
Lenti ORF particles, NTRK3 (Myc-DDK tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,330.00
3 Weeks
Lenti ORF particles, NTRK3 (mGFP-tagged) - Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
NTRK3 (Myc-DDK tagged) - Homo sapiens neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
NTRK3 (GFP-tagged) - Homo sapiens neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
NTRK3 (untagged)-Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
NTRK3 (untagged)-Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal TrkC Antibody
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the extracellular domain of the human TrkC protein (within residues 300-400). [UniProt Q16288]. |
Rabbit anti-NTRK3 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NTRK3 |
Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
NTRK3 (untagged)-Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
NTRK3 (untagged)-Kinase deficient mutant (K572M) of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
NTRK3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
NTRK3 (untagged)-Human neurotrophic tyrosine kinase, receptor, type 3, transcript variant 3 (cDNA clone MGC:17113 IMAGE:4181574), complete cds
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
NTRK3 (untagged)-Kinase deficient mutant (K572M) of Human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Recombinant protein of human mitotic spindle organizing protein 2A (MZT2A), residues 32-429aa, with C-terminal DDK tag, expressed in sf9, 20ug
Tag | C-DDK |
Expression Host | Sf9 |
Rabbit polyclonal TrkC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TrkC antibody is generated from rabbits immunized with a his tag recombinant protein of human TrkC. |
Rabbit Polyclonal Anti-NTRK3
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NTRK3 antibody: synthetic peptide directed towards the C terminal of human NTRK3. Synthetic peptide located within the following region: ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG |
Carrier-free (BSA/glycerol-free) NTRK3 mouse monoclonal antibody, clone OTI24B3 (formerly 24B3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NTRK3 mouse monoclonal antibody, clone OTI2B8 (formerly 2B8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NTRK3 mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |