Products

cDNA Clones (41)
Proteins (26)
Antibodies (5)
Jump to Filters
View as table Download
PAX6 (NM_000280) Human Tagged ORF Clone
RC203815

USD 420.00

In Stock

PAX6 (Myc-DDK-tagged)-Human paired box 6 (PAX6), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PAX6 (NM_001604) Human Tagged ORF Clone
RC222644

USD 420.00

In Stock

PAX6 (Myc-DDK-tagged)-Human paired box 6 (PAX6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PAX6 (NM_000280) Human Untagged Clone
SC127933

USD 310.00

In Stock

PAX6 (untagged)-Human paired box 6 (PAX6), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PAX6 (NM_001604) Human Tagged ORF Clone
RG222644

USD 460.00

In Stock

PAX6 (GFP-tagged) - Human paired box 6 (PAX6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX6 (NM_000280) Human Tagged ORF Clone Lentiviral Particle
RC203815L1V

USD 820.00

3 Weeks

Lenti ORF particles, PAX6 (Myc-DDK tagged) - Human paired box 6 (PAX6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PAX6 (NM_000280) Human Tagged ORF Clone Lentiviral Particle
RC203815L2V

USD 820.00

6 Weeks

Lenti ORF particles, PAX6 (mGFP-tagged) - Human paired box 6 (PAX6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PAX6 (NM_001604) Human Tagged ORF Clone Lentiviral Particle
RC222644L1V

USD 820.00

3 Weeks

Lenti ORF particles, PAX6 (Myc-DDK tagged) - Human paired box 6 (PAX6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PAX6 (NM_001604) Human Tagged ORF Clone Lentiviral Particle
RC222644L2V

USD 820.00

6 Weeks

Lenti ORF particles, PAX6 (mGFP-tagged) - Human paired box 6 (PAX6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PAX6 (NM_000280) Human Tagged ORF Clone
RG203815

USD 460.00

In Stock

PAX6 (GFP-tagged) - Human paired box 6 (PAX6), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX6 (NM_001127612) Human Tagged ORF Clone
RC225676

USD 420.00

In Stock

PAX6 (Myc-DDK-tagged)-Human paired box 6 (PAX6), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX6 (NM_001258464) Human Tagged ORF Clone
RC232693

USD 420.00

In Stock

PAX6 (Myc-DDK tagged) - Homo sapiens paired box 6 (PAX6), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX6 (NM_001258465) Human Tagged ORF Clone
RC232694

USD 420.00

In Stock

PAX6 (Myc-DDK tagged) - Homo sapiens paired box 6 (PAX6), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX6 (NM_001258462) Human Tagged ORF Clone
RC232724

USD 420.00

In Stock

PAX6 (Myc-DDK tagged) - Homo sapiens paired box 6 (PAX6), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX6 (NM_001258463) Human Tagged ORF Clone
RC232725

USD 420.00

In Stock

PAX6 (Myc-DDK tagged) - Homo sapiens paired box 6 (PAX6), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX6 (NM_000280) Human Tagged ORF Clone Lentiviral Particle
RC203815L3V

USD 820.00

7 Weeks

Lenti ORF particles, PAX6 (Myc-DDK tagged) - Human paired box 6 (PAX6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX6 (NM_000280) Human Tagged ORF Clone Lentiviral Particle
RC203815L4V

USD 820.00

3 Weeks

Lenti ORF particles, PAX6 (mGFP-tagged) - Human paired box 6 (PAX6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX6 (NM_001604) Human Tagged ORF Clone
RC222644L3

USD 620.00

3 Weeks

Lenti ORF clone of Human paired box 6 (PAX6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX6 (NM_001604) Human Tagged ORF Clone Lentiviral Particle
RC222644L3V

USD 820.00

5 Weeks

Lenti ORF particles, PAX6 (Myc-DDK tagged) - Human paired box 6 (PAX6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX6 (NM_001604) Human Tagged ORF Clone
RC222644L4

USD 620.00

3 Weeks

Lenti ORF clone of Human paired box 6 (PAX6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX6 (NM_001604) Human Tagged ORF Clone Lentiviral Particle
RC222644L4V

USD 820.00

7 Weeks

Lenti ORF particles, PAX6 (mGFP-tagged) - Human paired box 6 (PAX6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX6 (NM_001127612) Human Tagged ORF Clone
RC225676L3

USD 620.00

3 Weeks

Lenti-ORF clone of PAX6 (Myc-DDK-tagged)-Human paired box 6 (PAX6), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX6 (NM_001127612) Human Tagged ORF Clone
RC225676L4

USD 620.00

3 Weeks

Lenti-ORF clone of PAX6 (mGFP-tagged)-Human paired box 6 (PAX6), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX6 (NM_001127612) Human Tagged ORF Clone
RG225676

USD 460.00

3 Weeks

PAX6 (GFP-tagged) - Human paired box 6 (PAX6), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX6 (NM_001258464) Human Tagged ORF Clone
RG232693

USD 460.00

3 Weeks

PAX6 (GFP-tagged) - Homo sapiens paired box 6 (PAX6), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX6 (NM_001258465) Human Tagged ORF Clone
RG232694

USD 460.00

3 Weeks

PAX6 (GFP-tagged) - Homo sapiens paired box 6 (PAX6), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX6 (NM_001258462) Human Tagged ORF Clone
RG232724

USD 460.00

3 Weeks

PAX6 (GFP-tagged) - Homo sapiens paired box 6 (PAX6), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX6 (NM_001258463) Human Tagged ORF Clone
RG232725

USD 460.00

3 Weeks

PAX6 (GFP-tagged) - Homo sapiens paired box 6 (PAX6), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX6 (NM_001604) Human Recombinant Protein
TP760453

USD 215.00

In Stock

Purified recombinant protein of Human paired box 6 (PAX6), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
PAX6 (NM_000280) Human Tagged Lenti ORF Clone
RC203815L1

USD 768.00

In Stock

Lenti ORF clone of Human paired box 6 (PAX6), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PAX6 (NM_001604) Human Tagged ORF Clone
RC222644L1

USD 768.00

In Stock

Lenti ORF clone of Human paired box 6 (PAX6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PAX6 (NM_000280) Human Over-expression Lysate
LY400107

USD 396.00

In Stock

Transient overexpression lysate of paired box 6 (PAX6), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAX6 (NM_001604) Human Untagged Clone
SC109551

USD 740.00

In Stock

PAX6 (untagged)-Human paired box 6 (PAX6), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PAX6 (NM_001604) Human Over-expression Lysate
LY419854

USD 605.00

5 Days

Transient overexpression lysate of paired box 6 (PAX6), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAX6 Rabbit Polyclonal Antibody
AP53180PU-N

USD 450.00

2 Weeks

PAX6 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Recombinant protein from human PAX6
PAX6 (NM_001604) Human Over-expression Lysate
LC419854

USD 187.00

In Stock

PAX6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAX6 (NM_000280) Human Tagged ORF Clone
RC203815L2

USD 620.00

3 Weeks

Lenti ORF clone of Human paired box 6 (PAX6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PAX6 (NM_001604) Human Tagged ORF Clone
RC222644L2

USD 620.00

3 Weeks

Lenti ORF clone of Human paired box 6 (PAX6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PAX6 (NM_000280) Human Over-expression Lysate
LC400107

USD 121.00

In Stock

PAX6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
PAX6 Rabbit Polyclonal Antibody
TA335202

USD 375.00

5 Days

Rabbit Polyclonal Anti-PAX6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX6 antibody: synthetic peptide directed towards the N terminal of human PAX6. Synthetic peptide located within the following region: LAHSGARPCDISRILQTHADAKVQVLDNQNVSNGCVSKILGRYYETGSIR
PAX6 (Center) Rabbit Polyclonal Antibody
AP17622PU-N

USD 450.00

2 Weeks

PAX6 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human PAX6
PAX6 Rabbit Polyclonal Antibody
TA318938

USD 355.00

3 Weeks

Rabbit polyclonal anti-PAX6 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 303 of rat PAX6
PAX6 Rabbit Polyclonal Antibody
TA331135

USD 375.00

5 Days

Rabbit Polyclonal Anti-PAX6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX6 antibody: synthetic peptide directed towards the N terminal of human PAX6. Synthetic peptide located within the following region: GRPLPDSTRQKIVELAHSGARPCDISRILQTHADAKVQVLDNQNVSNGCV
PAX6 (NM_001127612) Human Untagged Clone
SC323044

USD 760.00

3 Weeks

PAX6 (untagged)-Human paired box 6 (PAX6), transcript variant 3

Vector pCMV6 series
Tag Tag Free
PAX6 (NM_001258462) Human Untagged Clone
SC330686

USD 430.00

3 Weeks

PAX6 (untagged) - Homo sapiens paired box 6 (PAX6), transcript variant 4

Vector pCMV6 series
Tag Tag Free
PAX6 (NM_001258463) Human Untagged Clone
SC330687

USD 430.00

3 Weeks

PAX6 (untagged) - Homo sapiens paired box 6 (PAX6), transcript variant 5

Vector pCMV6 series
Tag Tag Free
PAX6 (NM_001258464) Human Untagged Clone
SC330688

USD 420.00

3 Weeks

PAX6 (untagged) - Homo sapiens paired box 6 (PAX6), transcript variant 6

Vector pCMV6 series
Tag Tag Free