PDE2A (Myc-DDK-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PDE2A (Myc-DDK-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PDE2A (GFP-tagged) - Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PDE2A (GFP-tagged) - Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PDE2A (GFP-tagged) - Homo sapiens phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PDE2A (Myc-DDK tagged) - Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PDE2A (mGFP-tagged) - Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PDE2A (untagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PDE2A (Myc-DDK tagged) - Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PDE2A (mGFP-tagged) - Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PDE2A (Myc-DDK-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of PDE2A (Myc-DDK-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PDE2A (Myc-DDK-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PDE2A (mGFP-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PDE2A (mGFP-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PDE2A (Myc-DDK-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of PDE2A (Myc-DDK-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 4
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PDE2A (Myc-DDK-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PDE2A (mGFP-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 4
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PDE2A (mGFP-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PDE2A (Myc-DDK tagged) - Homo sapiens phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PDE2A (GFP-tagged) - Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PDE2A HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-PDE2A Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | Pde2 / PDE2A antibody was raised against synthetic 17 amino acid peptide from N-terminus of human PDE2A. Percent identity with other species by BLAST analysis: Human, Gorilla, Marmoset, Dog, Panda, Horse (100%); Gibbon, Monkey, Mouse, Rat, Bovine, Elephant, Rabbit (94%); Pig (88%). |
Rabbit polyclonal Anti-Pde2a Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Pde2a antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CRSQQYPAARPAEPRGQQVFLKPDEPPPQPCADSLQDALLSLGAVIDIAG |
Carrier-free (BSA/glycerol-free) PDE2A mouse monoclonal antibody, clone OTI5D9 (formerly 5D9)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDE2A mouse monoclonal antibody, clone OTI5B10 (formerly 5B10)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDE2A mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDE2A mouse monoclonal antibody, clone OTI4H8 (formerly 4H8)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDE2A mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDE2A mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDE2A mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDE2A mouse monoclonal antibody, clone OTI3A4 (formerly 3A4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDE2A mouse monoclonal antibody, clone OTI4D10 (formerly 4D10)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PDE2A (untagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
PDE2A (untagged)-Human phosphodiesterase 2A cGMP-stimulated (PDE2A) transcript variant 4
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PDE2A (untagged) - Homo sapiens phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
PDE2A mouse monoclonal antibody, clone OTI5D9 (formerly 5D9)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PDE2A mouse monoclonal antibody, clone OTI5D9 (formerly 5D9), Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PDE2A mouse monoclonal antibody, clone OTI5D9 (formerly 5D9), HRP conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PDE2A mouse monoclonal antibody, clone OTI5D9 (formerly 5D9)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PDE2A mouse monoclonal antibody, clone OTI5B10 (formerly 5B10)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PDE2A mouse monoclonal antibody, clone OTI5B10 (formerly 5B10), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PDE2A mouse monoclonal antibody, clone OTI5B10 (formerly 5B10), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PDE2A mouse monoclonal antibody, clone OTI5B10 (formerly 5B10)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PDE2A mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |