Products

Antibodies (47)
cDNA Clones (28)
Proteins (11)
Jump to Filters
View as table Download
PDE2A (NM_002599) Human Tagged ORF Clone
RC207219

USD 750.00

In Stock

PDE2A (Myc-DDK-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PDE2A (NM_002599) Human Tagged ORF Clone
RG207219

USD 830.00

In Stock

PDE2A (GFP-tagged) - Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE2A (NM_001143839) Human Tagged ORF Clone
RG226806

USD 830.00

In Stock

PDE2A (GFP-tagged) - Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE2A (NM_001243784) Human Tagged ORF Clone
RG235036

USD 830.00

In Stock

PDE2A (GFP-tagged) - Homo sapiens phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE2A (NM_002599) Human Tagged ORF Clone Lentiviral Particle
RC207219L1V

USD 1,150.00

3 Weeks

Lenti ORF particles, PDE2A (Myc-DDK tagged) - Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PDE2A (NM_002599) Human Tagged ORF Clone Lentiviral Particle
RC207219L2V

USD 1,150.00

6 Weeks

Lenti ORF particles, PDE2A (mGFP-tagged) - Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PDE2A (NM_002599) Human Untagged Clone
SC110970

USD 310.00

In Stock

PDE2A (untagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
PDE2A (NM_002599) Human Tagged ORF Clone
RC207219L3

USD 950.00

3 Weeks

Lenti ORF clone of Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE2A (NM_002599) Human Tagged ORF Clone Lentiviral Particle
RC207219L3V

USD 1,150.00

5 Weeks

Lenti ORF particles, PDE2A (Myc-DDK tagged) - Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE2A (NM_002599) Human Tagged ORF Clone
RC207219L4

USD 950.00

3 Weeks

Lenti ORF clone of Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE2A (NM_002599) Human Tagged ORF Clone Lentiviral Particle
RC207219L4V

USD 1,150.00

7 Weeks

Lenti ORF particles, PDE2A (mGFP-tagged) - Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE2A (NM_001143839) Human Tagged ORF Clone
RC226806

USD 750.00

3 Weeks

PDE2A (Myc-DDK-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE2A (NM_001143839) Human Tagged ORF Clone
RC226806L3

USD 950.00

3 Weeks

Lenti-ORF clone of PDE2A (Myc-DDK-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE2A (NM_001143839) Human Tagged ORF Clone Lentiviral Particle
RC226806L3V

USD 1,150.00

6 Weeks

Lenti ORF particles, PDE2A (Myc-DDK-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE2A (NM_001143839) Human Tagged ORF Clone
RC226806L4

USD 950.00

3 Weeks

Lenti-ORF clone of PDE2A (mGFP-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE2A (NM_001143839) Human Tagged ORF Clone Lentiviral Particle
RC226806L4V

USD 1,150.00

6 Weeks

Lenti ORF particles, PDE2A (mGFP-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE2A (NM_001146209) Human Tagged ORF Clone
RC228618

USD 750.00

5 Weeks

PDE2A (Myc-DDK-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE2A (NM_001146209) Human Tagged ORF Clone
RC228618L3

USD 950.00

5 Weeks

Lenti-ORF clone of PDE2A (Myc-DDK-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE2A (NM_001146209) Human Tagged ORF Clone Lentiviral Particle
RC228618L3V

USD 1,150.00

8 Weeks

Lenti ORF particles, PDE2A (Myc-DDK-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE2A (NM_001146209) Human Tagged ORF Clone
RC228618L4

USD 950.00

5 Weeks

Lenti-ORF clone of PDE2A (mGFP-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE2A (NM_001146209) Human Tagged ORF Clone Lentiviral Particle
RC228618L4V

USD 1,150.00

8 Weeks

Lenti ORF particles, PDE2A (mGFP-tagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE2A (NM_001243784) Human Tagged ORF Clone
RC235036

USD 750.00

3 Weeks

PDE2A (Myc-DDK tagged) - Homo sapiens phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE2A (NM_001146209) Human Tagged ORF Clone
RG228618

USD 830.00

5 Weeks

PDE2A (GFP-tagged) - Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE2A (NM_002599) Human Tagged ORF Clone
RC207219L1

USD 1,176.00

In Stock

Lenti ORF clone of Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PDE2A (NM_002599) Human Over-expression Lysate
LY419215

USD 396.00

5 Days

Transient overexpression lysate of phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PDE2A (NM_002599) Human Tagged ORF Clone
RC207219L2

USD 950.00

3 Weeks

Lenti ORF clone of Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PDE2A (NM_002599) Human Over-expression Lysate
LC419215

USD 121.00

In Stock

PDE2A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PDE2A Rabbit Polyclonal Antibody
TA341106

USD 425.00

5 Days

Rabbit Polyclonal Anti-PDE2A Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen Pde2 / PDE2A antibody was raised against synthetic 17 amino acid peptide from N-terminus of human PDE2A. Percent identity with other species by BLAST analysis: Human, Gorilla, Marmoset, Dog, Panda, Horse (100%); Gibbon, Monkey, Mouse, Rat, Bovine, Elephant, Rabbit (94%); Pig (88%).
PDE2A Rabbit Polyclonal Antibody
TA342145

USD 375.00

5 Days

Rabbit polyclonal Anti-Pde2a Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Pde2a antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CRSQQYPAARPAEPRGQQVFLKPDEPPPQPCADSLQDALLSLGAVIDIAG
PDE2A Mouse Monoclonal Antibody [Clone ID: OTI5D9]
CF502318

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PDE2A mouse monoclonal antibody, clone OTI5D9 (formerly 5D9)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDE2A Mouse Monoclonal Antibody [Clone ID: OTI5B10]
CF502319

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PDE2A mouse monoclonal antibody, clone OTI5B10 (formerly 5B10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDE2A Mouse Monoclonal Antibody [Clone ID: OTI1G9]
CF502320

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PDE2A mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDE2A Mouse Monoclonal Antibody [Clone ID: OTI4H8]
CF502321

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PDE2A mouse monoclonal antibody, clone OTI4H8 (formerly 4H8)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDE2A Mouse Monoclonal Antibody [Clone ID: OTI2A5]
CF502349

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PDE2A mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDE2A Mouse Monoclonal Antibody [Clone ID: OTI4D2]
CF502353

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PDE2A mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDE2A Mouse Monoclonal Antibody [Clone ID: OTI2F1]
CF502354

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PDE2A mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDE2A Mouse Monoclonal Antibody [Clone ID: OTI3A4]
CF502389

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PDE2A mouse monoclonal antibody, clone OTI3A4 (formerly 3A4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDE2A Mouse Monoclonal Antibody [Clone ID: OTI4D10]
CF502683

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PDE2A mouse monoclonal antibody, clone OTI4D10 (formerly 4D10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDE2A (NM_001143839) Human Untagged Clone
SC326291

USD 1,900.00

6 Weeks

PDE2A (untagged)-Human phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 2

Vector pCMV6 series
Tag Tag Free
PDE2A (NM_001146209) Human Untagged Clone
SC327253

USD 1,900.00

5 Weeks

PDE2A (untagged)-Human phosphodiesterase 2A cGMP-stimulated (PDE2A) transcript variant 4

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PDE2A (NM_001243784) Human Untagged Clone
SC332038

USD 930.00

5 Weeks

PDE2A (untagged) - Homo sapiens phosphodiesterase 2A, cGMP-stimulated (PDE2A), transcript variant 3

Vector pCMV6 series
Tag Tag Free
PDE2A Mouse Monoclonal Antibody [Clone ID: OTI5D9]
TA502318

USD 379.00

In Stock

PDE2A mouse monoclonal antibody, clone OTI5D9 (formerly 5D9)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDE2A Mouse Monoclonal Antibody [Clone ID: OTI5D9]
TA502318S

USD 159.00

2 Days

PDE2A mouse monoclonal antibody, clone OTI5D9 (formerly 5D9)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDE2A Mouse Monoclonal Antibody [Clone ID: OTI5B10]
TA502319

USD 379.00

In Stock

PDE2A mouse monoclonal antibody, clone OTI5B10 (formerly 5B10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDE2A Mouse Monoclonal Antibody [Clone ID: OTI5B10]
TA502319S

USD 159.00

2 Days

PDE2A mouse monoclonal antibody, clone OTI5B10 (formerly 5B10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDE2A Mouse Monoclonal Antibody [Clone ID: OTI1G9]
TA502320

USD 379.00

In Stock

PDE2A mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated