Products

cDNA Clones (22)
Proteins (8)
Antibodies (2)
Jump to Filters
View as table Download
SETDB2 (NM_001160308) Human Tagged ORF Clone
RC229002

USD 610.00

In Stock

SETDB2 (Myc-DDK-tagged)-Human SET domain, bifurcated 2 (SETDB2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SETDB2 (NM_031915) Human Tagged ORF Clone
RC222183

USD 610.00

In Stock

SETDB2 (Myc-DDK-tagged)-Human SET domain, bifurcated 2 (SETDB2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SETDB2 (NM_031915) Human Tagged ORF Clone Lentiviral Particle
RC222183L1V

USD 1,010.00

3 Weeks

Lenti ORF particles, SETDB2 (Myc-DDK tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SETDB2 (NM_031915) Human Tagged ORF Clone Lentiviral Particle
RC222183L2V

USD 1,010.00

6 Weeks

Lenti ORF particles, SETDB2 (mGFP-tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SETDB2 (NM_001160308) Human Tagged ORF Clone Lentiviral Particle
RC229002L1V

USD 1,010.00

3 Weeks

Lenti ORF particles, SETDB2 (Myc-DDK tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SETDB2 (NM_001160308) Human Tagged ORF Clone Lentiviral Particle
RC229002L2V

USD 1,010.00

6 Weeks

Lenti ORF particles, SETDB2 (mGFP-tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SETDB2 (NM_031915) Human Tagged ORF Clone
RG222183

USD 670.00

In Stock

SETDB2 (GFP-tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SETDB2 (NM_031915) Human Tagged ORF Clone
RC222183L3

USD 810.00

3 Weeks

Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SETDB2 (NM_031915) Human Tagged ORF Clone Lentiviral Particle
RC222183L3V

USD 1,010.00

5 Weeks

Lenti ORF particles, SETDB2 (Myc-DDK tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SETDB2 (NM_031915) Human Tagged ORF Clone
RC222183L4

USD 810.00

3 Weeks

Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SETDB2 (NM_031915) Human Tagged ORF Clone Lentiviral Particle
RC222183L4V

USD 1,010.00

7 Weeks

Lenti ORF particles, SETDB2 (mGFP-tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SETDB2 (NM_001160308) Human Tagged ORF Clone
RC229002L3

USD 810.00

3 Weeks

Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SETDB2 (NM_001160308) Human Tagged ORF Clone Lentiviral Particle
RC229002L3V

USD 1,010.00

5 Weeks

Lenti ORF particles, SETDB2 (Myc-DDK tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SETDB2 (NM_001160308) Human Tagged ORF Clone
RC229002L4

USD 810.00

3 Weeks

Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SETDB2 (NM_001160308) Human Tagged ORF Clone Lentiviral Particle
RC229002L4V

USD 1,010.00

7 Weeks

Lenti ORF particles, SETDB2 (mGFP-tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SETDB2 (NM_001160308) Human Tagged ORF Clone
RG229002

USD 670.00

3 Weeks

SETDB2 (GFP-tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SETDB2 (NM_031915) Human Tagged Lenti ORF Clone
RC222183L1

USD 1,008.00

In Stock

Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SETDB2 (NM_001160308) Human Tagged ORF Clone
RC229002L1

USD 1,008.00

In Stock

Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SETDB2 Rabbit Polyclonal Antibody
TA346848

USD 475.00

5 Days

Rabbit Polyclonal Anti-SETDB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SETDB2 antibody: synthetic peptide directed towards the N terminal of human SETDB2. Synthetic peptide located within the following region: ASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTGNKE
SETDB2 (NM_031915) Human Tagged ORF Clone
RC222183L2

USD 810.00

3 Weeks

Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SETDB2 (NM_001160308) Human Tagged ORF Clone
RC229002L2

USD 810.00

3 Weeks

Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SETDB2 (NM_031915) Human Untagged Clone
SC127054

USD 1,460.00

In Stock

SETDB2 (untagged)-Human SET domain, bifurcated 2 (SETDB2), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SETDB2 Goat Polyclonal Antibody
TA302842

USD 375.00

5 Days

Goat Polyclonal Antibody against SETDB2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence GEKNGDAKTFWME-C, from the N Terminus of the protein sequence according to NP_114121.1.
SETDB2 (NM_001160308) Human Over-expression Lysate
LC432029

USD 187.00

2 Weeks

SETDB2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SETDB2 (NM_001160308) Human Untagged Clone
SC327637

USD 760.00

3 Weeks

SETDB2 (untagged)-Human SET domain bifurcated 2 (SETDB2) transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SETDB2 (NM_031915) ICC Control Block
TB422183

USD 1,260.00

4 Weeks

Transient overexpression of SETDB2 (NM_031915) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SETDB2 (NM_001160308) ICC Control Block
TB429002

USD 1,260.00

4 Weeks

Transient overexpression of SETDB2 (NM_001160308) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SETDB2 Cytosection
TS422183

USD 225.00

4 Weeks

Transient overexpression of SETDB2 (NM_031915) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SETDB2 Cytosection
TS422183P5

USD 889.00

4 Weeks

Transient overexpression of SETDB2 (NM_031915) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

SETDB2 Cytosection
TS429002

USD 225.00

4 Weeks

Transient overexpression of SETDB2 (NM_001160308) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SETDB2 Cytosection
TS429002P5

USD 889.00

4 Weeks

Transient overexpression of SETDB2 (NM_001160308) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack