Germany
Japan
United Kingdom
China
SETDB2 (Myc-DDK-tagged)-Human SET domain, bifurcated 2 (SETDB2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
SETDB2 (Myc-DDK-tagged)-Human SET domain, bifurcated 2 (SETDB2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, SETDB2 (Myc-DDK tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SETDB2 (mGFP-tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, SETDB2 (Myc-DDK tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SETDB2 (mGFP-tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Setdb2 (Myc-DDK-tagged) - Mouse SET domain, bifurcated 2 (Setdb2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SETDB2 (GFP-tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SETDB2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN422183 is the updated version of KN222183.
Setdb2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN515633 is the updated version of KN315633.
Setdb2 (GFP-tagged) - Mouse SET domain bifurcated 2 (Setdb2), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Setdb2 (Myc-DDK-tagged) - Mouse SET domain, bifurcated 2 (Setdb2)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Setdb2 (Myc-DDK-tagged) - Mouse SET domain, bifurcated 2 (Setdb2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Setdb2 (mGFP-tagged) - Mouse SET domain, bifurcated 2 (Setdb2)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Setdb2 (GFP-tagged) - Mouse SET domain, bifurcated 2 (Setdb2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SETDB2 (Myc-DDK tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SETDB2 (mGFP-tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SETDB2 (Myc-DDK tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SETDB2 (mGFP-tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SETDB2 (GFP-tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-SETDB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SETDB2 antibody: synthetic peptide directed towards the N terminal of human SETDB2. Synthetic peptide located within the following region: ASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTGNKE |
Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
SETDB2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SETDB2 (untagged)-Human SET domain, bifurcated 2 (SETDB2), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Setdb2 - mouse gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
Transient overexpression lysate of SET domain, bifurcated 2 (SETDB2), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Goat Polyclonal Antibody against SETDB2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence GEKNGDAKTFWME-C, from the N Terminus of the protein sequence according to NP_114121.1. |
SETDB2 CRISPRa kit - CRISPR gene activation of human SET domain bifurcated histone lysine methyltransferase 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Setdb2 CRISPRa kit - CRISPR gene activation of mouse SET domain, bifurcated 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene SETDB2
Setdb2 - mouse gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 mBFP-Neo donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
Setdb2 - mouse gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 Luciferase-Puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
Setdb2 - mouse gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 RFP-BSD donor, 1 scramble control |
| Donor DNA | RFP-BSD |
SETDB2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Setdb2 (untagged) - Mouse SET domain, bifurcated 2 (Setdb2), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Setdb2
SETDB2 (untagged)-Human SET domain bifurcated 2 (SETDB2) transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Setdb2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
SETDB2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human SETDB2 (NP_001153780.1). |
| Modifications | Unmodified |
Transient overexpression of SETDB2 (NM_031915) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SETDB2 (NM_001160308) in HEK293T cells paraffin embedded controls for ICC/IHC staining
SETDB2 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
SETDB2 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- SETDB2