Germany
Japan
United Kingdom
China
SMN1 (Myc-DDK-tagged)-Human survival of motor neuron 1, telomeric (SMN1), transcript variant d
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
SMN1 (Myc-DDK-tagged)-Human survival of motor neuron 1, telomeric (SMN1), transcript variant b
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, SMN1 (Myc-DDK tagged) - Human survival of motor neuron 1, telomeric (SMN1), transcript variant d, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SMN1 (untagged)-Human survival of motor neuron 1, telomeric (SMN1), transcript variant d
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SMN1 (GFP-tagged) - Human survival of motor neuron 1, telomeric (SMN1), transcript variant b
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SMN1 (GFP-tagged) - Human survival of motor neuron 1, telomeric (SMN1), transcript variant d
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, SMN1 (Myc-DDK tagged) - Human survival of motor neuron 1, telomeric (SMN1), transcript variant b, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SMN1 (mGFP-tagged) - Human survival of motor neuron 1, telomeric (SMN1), transcript variant b, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, SMN1 (Myc-DDK tagged) - Human survival of motor neuron 1, telomeric (SMN1), transcript variant d, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SMN1 (mGFP-tagged) - Human survival of motor neuron 1, telomeric (SMN1), transcript variant d, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human survival of motor neuron 1, telomeric (SMN1), transcript variant b, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SMN1 (Myc-DDK tagged) - Human survival of motor neuron 1, telomeric (SMN1), transcript variant b, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human survival of motor neuron 1, telomeric (SMN1), transcript variant b, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SMN1 (mGFP-tagged) - Human survival of motor neuron 1, telomeric (SMN1), transcript variant b, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human survival of motor neuron 1, telomeric (SMN1), transcript variant d, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SMN1 (mGFP-tagged) - Human survival of motor neuron 1, telomeric (SMN1), transcript variant d, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SMN1 (myc-DDK-tagged) - Human survival of motor neuron 1, telomeric (SMN1), transcript variant a
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-SMN1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMN1 antibody: synthetic peptide directed towards the N terminal of human SMN1. Synthetic peptide located within the following region: KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKV |
Lenti ORF clone of Human survival of motor neuron 1, telomeric (SMN1), transcript variant d, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Transient overexpression lysate of survival of motor neuron 1, telomeric (SMN1), transcript variant d
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human survival of motor neuron 1, telomeric (SMN1), transcript variant b, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human survival of motor neuron 1, telomeric (SMN1), transcript variant d, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of survival of motor neuron 1, telomeric (SMN1), transcript variant b
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
SMN1 (untagged)-Human survival of motor neuron 1, telomeric (SMN1), transcript variant b
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SMN1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human survival of motor neuron 1, telomeric (SMN1), transcript variant b, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human survival of motor neuron 1, telomeric (SMN1), transcript variant d, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Goat Polyclonal Antibody against SMN1 / SMN2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DESENSRSPGNKSDN, from the internal region of the protein sequence according to NP_075012.1; NP_000335.1; NP_075013.1; NP_075014.1; NP_075015.1; NP_059107.1. |
SMN1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-SMN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMN1 antibody is: synthetic peptide directed towards the C-terminal region of SMN1. Synthetic peptide located within the following region: PPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSL |
Rabbit anti SMN (Survival of motor neuron) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to C-terminus of human SMN. |
SMN1 MS Standard C13 and N15-labeled recombinant protein (NP_075012)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
SMN1 MS Standard C13 and N15-labeled recombinant protein (NP_000335)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
SMN1 (GFP-tagged) - Human survival of motor neuron 1, telomeric (SMN1), transcript variant a
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SMN1 (untagged) - Human survival of motor neuron 1, telomeric (SMN1), transcript variant a
| Vector | pCMV6-Entry |
| Tag | Tag Free |
Rabbit Polyclonal Anti-SMN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SMN1 |
Transient overexpression of SMN1 (NM_022874) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SMN1 (NM_000344) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SMN1 (NM_001297715) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SMN1 (NM_022874) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SMN1 (NM_022874) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SMN1 (NM_000344) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SMN1 (NM_000344) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SMN1 (NM_001297715) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- SMN1
Families
- Druggable Genome