Products

View as table Download

USD 98.00

USD 470.00

In Stock

STK16 (Myc-DDK-tagged)-Human serine/threonine kinase 16 (STK16), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

STK16 (Myc-DDK-tagged)-Human serine/threonine kinase 16 (STK16), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, STK16 (Myc-DDK tagged) - Human serine/threonine kinase 16 (STK16), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, STK16 (mGFP-tagged) - Human serine/threonine kinase 16 (STK16), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, STK16 (Myc-DDK tagged) - Human serine/threonine kinase 16 (STK16), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, STK16 (mGFP-tagged) - Human serine/threonine kinase 16 (STK16), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Recombinant protein of human serine/threonine kinase 16 (STK16), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

STK16 (GFP-tagged) - Human serine/threonine kinase 16 (STK16), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

STK16 (GFP-tagged) - Human serine/threonine kinase 16 (STK16), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human serine/threonine kinase 16 (STK16), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, STK16 (Myc-DDK tagged) - Human serine/threonine kinase 16 (STK16), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human serine/threonine kinase 16 (STK16), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, STK16 (mGFP-tagged) - Human serine/threonine kinase 16 (STK16), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human serine/threonine kinase 16 (STK16), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, STK16 (Myc-DDK tagged) - Human serine/threonine kinase 16 (STK16), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human serine/threonine kinase 16 (STK16), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, STK16 (mGFP-tagged) - Human serine/threonine kinase 16 (STK16), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

STK16 (untagged)-Human serine/threonine kinase 16 (STK16), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Lenti ORF clone of Human serine/threonine kinase 16 (STK16), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human serine/threonine kinase 16 (STK16), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-STK16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STK16 antibody: synthetic peptide directed towards the middle region of human STK16. Synthetic peptide located within the following region: TDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNQLSIPQSPRHSSAL

STK16 (untagged)-Human serine/threonine kinase 16 (STK16), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

STK16 mouse monoclonal antibody, clone M2, Purified

Applications ELISA, IHC, RNAi, WB
Reactivities Human

Lenti ORF clone of Human serine/threonine kinase 16 (STK16), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human serine/threonine kinase 16 (STK16), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

STK16 (untagged)-Kinase deficient mutant (K49M) of Human serine/threonine kinase 16 (STK16), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

STK16 (1-305, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

STK16 (1-305, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

STK16 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

STK16 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

STK16 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of serine/threonine kinase 16 (STK16), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

LY418496 is the same product as LY429162.

STK16 MS Standard C13 and N15-labeled recombinant protein (NP_003682)

Tag C-Myc/DDK
Expression Host HEK293

STK16 MS Standard C13 and N15-labeled recombinant protein (NP_001008910)

Tag C-Myc/DDK
Expression Host HEK293

Rabbit Polyclonal Anti-STK16 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human STK16

Transient overexpression of STK16 (NM_003691) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of STK16 (NM_001008910) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of STK16 (NM_003691) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of STK16 (NM_003691) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of STK16 (NM_001008910) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of STK16 (NM_001008910) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack