Products

cDNA Clones (30)
Proteins (15)
Antibodies (2)
Jump to Filters
View as table Download
Synaptojanin (SYNJ1) (NM_203446) Human Tagged ORF Clone Lentiviral Particle
RC215278L3V

USD 1,760.00

6 Weeks

Lenti ORF particles, SYNJ1 (Myc-DDK tagged) - Human synaptojanin 1 (SYNJ1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Synaptojanin (SYNJ1) (NM_203446) Human Tagged ORF Clone
RC215278L4

USD 1,560.00

3 Weeks

Lenti ORF clone of Human synaptojanin 1 (SYNJ1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Synaptojanin (SYNJ1) (NM_003895) Human Tagged ORF Clone
RC223432

USD 1,690.00

7 Weeks

SYNJ1 (Myc-DDK-tagged)-Human synaptojanin 1 (SYNJ1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Synaptojanin (SYNJ1) (NM_003895) Human Tagged ORF Clone
RC223432L3

USD 1,890.00

10 Weeks

Lenti-ORF clone of SYNJ1 (Myc-DDK-tagged)-Human synaptojanin 1 (SYNJ1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Synaptojanin (SYNJ1) (NM_003895) Human Tagged ORF Clone Lentiviral Particle
RC223432L3V

USD 2,090.00

13 Weeks

Lenti ORF particles, SYNJ1 (Myc-DDK-tagged)-Human synaptojanin 1 (SYNJ1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Synaptojanin (SYNJ1) (NM_003895) Human Tagged ORF Clone
RC223432L4

USD 1,890.00

10 Weeks

Lenti-ORF clone of SYNJ1 (mGFP-tagged)-Human synaptojanin 1 (SYNJ1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Synaptojanin (SYNJ1) (NM_001160302) Human Tagged ORF Clone Lentiviral Particle
RC228665L3V

USD 1,760.00

6 Weeks

Lenti ORF particles, SYNJ1 (Myc-DDK tagged) - Human synaptojanin 1 (SYNJ1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Synaptojanin (SYNJ1) (NM_001160306) Human Tagged ORF Clone
RC228684

USD 1,600.00

6 Weeks

SYNJ1 (Myc-DDK-tagged)-Human synaptojanin 1 (SYNJ1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Synaptojanin (SYNJ1) (NM_001160306) Human Tagged ORF Clone Lentiviral Particle
RC228684L3V

USD 2,000.00

9 Weeks

Lenti ORF particles, SYNJ1 (Myc-DDK-tagged)-Human synaptojanin 1 (SYNJ1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Synaptojanin (SYNJ1) (NM_001160306) Human Tagged ORF Clone
RC228684L4

USD 1,800.00

6 Weeks

Lenti-ORF clone of SYNJ1 (mGFP-tagged)-Human synaptojanin 1 (SYNJ1), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Synaptojanin (SYNJ1) (NM_203446) Human Tagged ORF Clone
RG215278

USD 1,500.00

3 Weeks

SYNJ1 (GFP-tagged) - Human synaptojanin 1 (SYNJ1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Synaptojanin (SYNJ1) (NM_003895) Human Tagged ORF Clone
RG223432

USD 1,860.00

7 Weeks

SYNJ1 (GFP-tagged) - Human synaptojanin 1 (SYNJ1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Synaptojanin (SYNJ1) (NM_001160302) Human Tagged ORF Clone
RG228665

USD 1,500.00

3 Weeks

SYNJ1 (GFP-tagged) - Human synaptojanin 1 (SYNJ1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Synaptojanin (SYNJ1) (NM_001160306) Human Tagged ORF Clone
RG228684

USD 1,760.00

7 Weeks

SYNJ1 (GFP-tagged) - Human synaptojanin 1 (SYNJ1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Synaptojanin (SYNJ1) Rabbit Polyclonal Antibody
TA345862

USD 475.00

5 Days

Rabbit Polyclonal Anti-SYNJ1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYNJ1 antibody: synthetic peptide directed towards the N terminal of human SYNJ1. Synthetic peptide located within the following region: IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR
Synaptojanin (SYNJ1) Rabbit Polyclonal Antibody
TA344052

USD 475.00

5 Days

Rabbit Polyclonal Anti-SYNJ1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYNJ1 antibody: synthetic peptide directed towards the middle region of human SYNJ1. Synthetic peptide located within the following region: PGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPP
Synaptojanin (SYNJ1) (NM_203446) Human Over-expression Lysate
LC404294

USD 187.00

In Stock

SYNJ1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Synaptojanin (SYNJ1) (NM_203446) Human Untagged Clone
SC128032

USD 2,730.00

In Stock

SYNJ1 (untagged)-Human synaptojanin 1 (SYNJ1), transcript variant 2

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
Synaptojanin (SYNJ1) (NM_001160302) Human Over-expression Lysate
LC431693

USD 187.00

2 Weeks

SYNJ1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Synaptojanin (SYNJ1) (NM_203446) Human Mass Spec Standard
PH315278

USD 2,055.00

3 Weeks

SYNJ1 MS Standard C13 and N15-labeled recombinant protein (NP_982271)

Tag C-Myc/DDK
Expression Host HEK293
Synaptojanin (SYNJ1) (NM_003895) Human Untagged Clone
SC309424

USD 3,270.00

7 Weeks

SYNJ1 (untagged)-Human synaptojanin 1 (SYNJ1), transcript variant 1

Vector pCMV6 series
Tag Tag Free
Synaptojanin (SYNJ1) (NM_001160302) Human Untagged Clone
SC327300

USD 2,510.00

3 Weeks

SYNJ1 (untagged)-Human synaptojanin 1 (SYNJ1) transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Synaptojanin (SYNJ1) (NM_001160306) Human Untagged Clone
SC327319

USD 3,090.00

7 Weeks

SYNJ1 (untagged)-Human synaptojanin 1 (SYNJ1) transcript variant 4

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Synaptojanin (SYNJ1) (NM_203446) Human Untagged Clone
SC328070

USD 2,730.00

3 Weeks

SYNJ1 (untagged)-Human synaptojanin 1 (SYNJ1) transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Synaptojanin (SYNJ1) (NM_003895) Human Untagged Clone
SC328081

USD 3,270.00

8 Weeks

SYNJ1 (untagged)-Human synaptojanin 1 (SYNJ1) transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Synaptojanin (SYNJ1) (NM_203446) ICC Control Block
TB415278

USD 2,010.00

4 Weeks

Transient overexpression of SYNJ1 (NM_203446) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Synaptojanin (SYNJ1) (NM_003895) ICC Control Block
TB423432

USD 2,340.00

4 Weeks

Transient overexpression of SYNJ1 (NM_003895) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Synaptojanin (SYNJ1) (NM_001160302) ICC Control Block
TB428665

USD 2,010.00

4 Weeks

Transient overexpression of SYNJ1 (NM_001160302) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Synaptojanin (SYNJ1) (NM_001160306) ICC Control Block
TB428684

USD 2,250.00

4 Weeks

Transient overexpression of SYNJ1 (NM_001160306) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Synaptojanin (SYNJ1) Cytosection
TS415278

USD 225.00

4 Weeks

Transient overexpression of SYNJ1 (NM_203446) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Synaptojanin (SYNJ1) Cytosection
TS415278P5

USD 889.00

4 Weeks

Transient overexpression of SYNJ1 (NM_203446) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Synaptojanin (SYNJ1) ICC Control Sections
TS423432P5

USD 889.00

4 Weeks

Transient overexpression of SYNJ1 (NM_003895) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Synaptojanin (SYNJ1) Cytosection
TS428665

USD 225.00

4 Weeks

Transient overexpression of SYNJ1 (NM_001160302) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Synaptojanin (SYNJ1) Cytosection
TS428665P5

USD 889.00

4 Weeks

Transient overexpression of SYNJ1 (NM_001160302) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Synaptojanin (SYNJ1) ICC Control Sections
TS428684P5

USD 889.00

4 Weeks

Transient overexpression of SYNJ1 (NM_001160306) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack