Products

cDNA Clones (46)
Proteins (16)
RNAi (8)
Gene Expression (5)
Antibodies (4)
Jump to Filters
View as table Download
Synj1 (NM_001045515) Mouse Tagged ORF Clone
MR217696

USD 1,010.00

In Stock

Synj1 (Myc-DDK-tagged) - Mouse synaptojanin 1 (Synj1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Synj1 (NM_001164483) Mouse Tagged ORF Clone
MR218797

USD 1,270.00

In Stock

Synj1 (Myc-DDK-tagged) - Mouse synaptojanin 1 (Synj1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Synaptojanin (SYNJ1) Human Gene Knockout Kit (CRISPR)
KN415278

USD 1,290.00

2 Weeks

SYNJ1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN415278 is the updated version of KN215278.
Synj1 Mouse Gene Knockout Kit (CRISPR)
KN517063

USD 1,290.00

2 Weeks

Synj1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN517063 is the updated version of KN317063.
Synj1 (NM_001045515) Mouse Tagged ORF Clone
MG217696

USD 1,110.00

3 Weeks

Synj1 (GFP-tagged) - Mouse synaptojanin 1 (Synj1) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Synj1 (NM_001164483) Mouse Tagged ORF Clone
MG218797

USD 1,400.00

3 Weeks

Synj1 (GFP-tagged) - Mouse synaptojanin 1 (Synj1) transcript variant 1, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Synj1 (NM_001045515) Mouse Tagged ORF Clone
MR217696L3

USD 1,210.00

3 Weeks

Lenti ORF clone of Synj1 (Myc-DDK-tagged) - Mouse synaptojanin 1 (Synj1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Synj1 (NM_001045515) Mouse Tagged ORF Clone
MR217696L4

USD 1,210.00

3 Weeks

Lenti ORF clone of Synj1 (mGFP-tagged) - Mouse synaptojanin 1 (Synj1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Synj1 (NM_001045515) Mouse Tagged ORF Clone Lentiviral Particle
MR217696L4V

USD 1,410.00

6 Weeks

Lenti ORF particles, Synj1 (GFP-tagged) - Mouse synaptojanin 1 (Synj1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Synj1 (NM_001164483) Mouse Tagged ORF Clone
MR218797L3

USD 1,470.00

3 Weeks

Lenti ORF clone of Synj1 (Myc-DDK-tagged) - Mouse synaptojanin 1 (Synj1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Synj1 (NM_001164483) Mouse Tagged ORF Clone
MR218797L4

USD 1,470.00

3 Weeks

Lenti ORF clone of Synj1 (mGFP-tagged) - Mouse synaptojanin 1 (Synj1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Synj1 (NM_001164483) Mouse Tagged ORF Clone Lentiviral Particle
MR218797L4V

USD 1,670.00

6 Weeks

Lenti ORF particles, Synj1 (GFP-tagged) - Mouse synaptojanin 1 (Synj1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Synaptojanin (SYNJ1) (NM_203446) Human Tagged ORF Clone Lentiviral Particle
RC215278L3V

USD 1,760.00

6 Weeks

Lenti ORF particles, SYNJ1 (Myc-DDK tagged) - Human synaptojanin 1 (SYNJ1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Synaptojanin (SYNJ1) (NM_203446) Human Tagged ORF Clone
RC215278L4

USD 1,560.00

3 Weeks

Lenti ORF clone of Human synaptojanin 1 (SYNJ1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Synaptojanin (SYNJ1) (NM_003895) Human Tagged ORF Clone
RC223432

USD 1,690.00

7 Weeks

SYNJ1 (Myc-DDK-tagged)-Human synaptojanin 1 (SYNJ1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Synaptojanin (SYNJ1) (NM_003895) Human Tagged ORF Clone
RC223432L3

USD 1,890.00

10 Weeks

Lenti-ORF clone of SYNJ1 (Myc-DDK-tagged)-Human synaptojanin 1 (SYNJ1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Synaptojanin (SYNJ1) (NM_003895) Human Tagged ORF Clone Lentiviral Particle
RC223432L3V

USD 2,090.00

13 Weeks

Lenti ORF particles, SYNJ1 (Myc-DDK-tagged)-Human synaptojanin 1 (SYNJ1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Synaptojanin (SYNJ1) (NM_003895) Human Tagged ORF Clone
RC223432L4

USD 1,890.00

10 Weeks

Lenti-ORF clone of SYNJ1 (mGFP-tagged)-Human synaptojanin 1 (SYNJ1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Synaptojanin (SYNJ1) (NM_001160302) Human Tagged ORF Clone Lentiviral Particle
RC228665L3V

USD 1,760.00

6 Weeks

Lenti ORF particles, SYNJ1 (Myc-DDK tagged) - Human synaptojanin 1 (SYNJ1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Synaptojanin (SYNJ1) (NM_001160306) Human Tagged ORF Clone
RC228684

USD 1,600.00

6 Weeks

SYNJ1 (Myc-DDK-tagged)-Human synaptojanin 1 (SYNJ1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Synaptojanin (SYNJ1) (NM_001160306) Human Tagged ORF Clone Lentiviral Particle
RC228684L3V

USD 2,000.00

9 Weeks

Lenti ORF particles, SYNJ1 (Myc-DDK-tagged)-Human synaptojanin 1 (SYNJ1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Synaptojanin (SYNJ1) (NM_001160306) Human Tagged ORF Clone
RC228684L4

USD 1,800.00

6 Weeks

Lenti-ORF clone of SYNJ1 (mGFP-tagged)-Human synaptojanin 1 (SYNJ1), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Synaptojanin (SYNJ1) (NM_203446) Human Tagged ORF Clone
RG215278

USD 1,500.00

3 Weeks

SYNJ1 (GFP-tagged) - Human synaptojanin 1 (SYNJ1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Synaptojanin (SYNJ1) (NM_003895) Human Tagged ORF Clone
RG223432

USD 1,860.00

7 Weeks

SYNJ1 (GFP-tagged) - Human synaptojanin 1 (SYNJ1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Synaptojanin (SYNJ1) (NM_001160302) Human Tagged ORF Clone
RG228665

USD 1,500.00

3 Weeks

SYNJ1 (GFP-tagged) - Human synaptojanin 1 (SYNJ1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Synaptojanin (SYNJ1) (NM_001160306) Human Tagged ORF Clone
RG228684

USD 1,760.00

7 Weeks

SYNJ1 (GFP-tagged) - Human synaptojanin 1 (SYNJ1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Synj1 (NM_053476) Rat Tagged ORF Clone
RR202059

USD 2,180.00

7 Weeks

Synj1 (Myc-DDK-tagged ORF) - Rat synaptojanin 1 (Synj1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Synaptojanin (SYNJ1) Rabbit Polyclonal Antibody
TA345862

USD 475.00

5 Days

Rabbit Polyclonal Anti-SYNJ1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYNJ1 antibody: synthetic peptide directed towards the N terminal of human SYNJ1. Synthetic peptide located within the following region: IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR
Synaptojanin (SYNJ1) Rabbit Polyclonal Antibody
TA344052

USD 475.00

5 Days

Rabbit Polyclonal Anti-SYNJ1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYNJ1 antibody: synthetic peptide directed towards the middle region of human SYNJ1. Synthetic peptide located within the following region: PGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPP
Synj1 Mouse siRNA Oligo Duplex (Locus ID 104015)
SR422634

USD 430.00

In Stock

Synj1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).
Synj1 Mouse Monoclonal Antibody [Clone ID: 5H1]
TA309245

USD 415.00

5 Days

Mouse Anti-Synaptojanin 1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Synj1 Rat shRNA Plasmid (Locus ID 85238)
TL711888

USD 815.00

In Stock

Synj1 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
Synaptojanin (SYNJ1) (NM_203446) Human Over-expression Lysate
LC404294

USD 187.00

In Stock

SYNJ1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Synaptojanin (SYNJ1) (NM_203446) Human Untagged Clone
SC128032

USD 2,730.00

In Stock

SYNJ1 (untagged)-Human synaptojanin 1 (SYNJ1), transcript variant 2

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
Human Synaptojanin (SYNJ1) activation kit by CRISPRa
GA105902

USD 1,290.00

2 Weeks

SYNJ1 CRISPRa kit - CRISPR gene activation of human synaptojanin 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Synj1 activation kit by CRISPRa
GA211779

USD 1,290.00

2 Weeks

Synj1 CRISPRa kit - CRISPR gene activation of mouse synaptojanin 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Synaptojanin (SYNJ1) Human qPCR Primer Pair (NM_003895)
HP207338

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene SYNJ1

Synaptojanin (SYNJ1) (NM_001160302) Human Over-expression Lysate
LC431693

USD 187.00

2 Weeks

SYNJ1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB