Products

Proteins (15)
cDNA Clones (14)
Antibodies (2)
Jump to Filters
View as table Download
Neurokinin B (TAC3) (NM_013251) Human Tagged ORF Clone
RC205666L4

USD 620.00

3 Weeks

Lenti ORF clone of Human tachykinin 3 (TAC3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Neurokinin B (TAC3) (NM_001178054) Human Tagged ORF Clone
RC229531

USD 420.00

2 Weeks

TAC3 (Myc-DDK-tagged)-Human tachykinin 3 (TAC3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Neurokinin B (TAC3) (NM_013251) Human Tagged ORF Clone
RG205666

USD 460.00

3 Weeks

TAC3 (GFP-tagged) - Human tachykinin 3 (TAC3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Neurokinin B (TAC3) (NM_001178054) Human Tagged ORF Clone
RG229531

USD 460.00

3 Weeks

TAC3 (GFP-tagged) - Human tachykinin 3 (TAC3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Neurokinin B (TAC3) (NM_013251) Human Untagged Clone
SC115350

USD 310.00

In Stock

TAC3 (untagged)-Human tachykinin 3 (TAC3), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Neurokinin B (TAC3) Rabbit Polyclonal Antibody
TA346470

USD 475.00

5 Days

Rabbit Polyclonal Anti-TAC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAC3 antibody: synthetic peptide directed towards the middle region of human TAC3. Synthetic peptide located within the following region: RSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDF
Neurokinin B (TAC3) (NM_013251) Human Over-expression Lysate
LC415710

USD 121.00

In Stock

TAC3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Neurokinin B (TAC3) (NM_013251) Human Over-expression Lysate
LY415710

USD 396.00

5 Days

Transient overexpression lysate of tachykinin 3 (TAC3)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Neurokinin B (TAC3) Rabbit Polyclonal Antibody
TA309892

USD 457.00

5 Days

Rabbit Polyclonal Neurokinin B Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal sequence of amino acids of the mouse proNKB protein (~93% homology to the rat sequence).
Neurokinin B / TAC3 (17-121, His-tag) Human Protein
AR09243PU-L

USD 845.00

2 Weeks

Neurokinin B / TAC3 (17-121, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Neurokinin B / TAC3 (17-121, His-tag) Human Protein
AR09243PU-N

USD 330.00

2 Weeks

Neurokinin B / TAC3 (17-121, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Neurokinin B (TAC3) (NM_013251) Human Mass Spec Standard
PH305666

USD 2,055.00

3 Weeks

TAC3 MS Standard C13 and N15-labeled recombinant protein (NP_037383)

Tag C-Myc/DDK
Expression Host HEK293
Neurokinin B (TAC3) (NM_001178054) Human Untagged Clone
SC328169

USD 420.00

2 Weeks

TAC3 (untagged)-Human tachykinin 3 (TAC3) transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Neurokinin B (TAC3) ICC Control Block
TB405666

USD 1,040.00

4 Weeks

Transient overexpression of TAC3 (NM_013251) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Neurokinin B (TAC3) ICC Control Block
TB429531

USD 1,070.00

4 Weeks

Transient overexpression of TAC3 (NM_001178054) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Neurokinin B (TAC3) (NM_013251) Human Recombinant Protein
TP720967

USD 330.00

3 Weeks

Purified recombinant protein of Human tachykinin 3 (TAC3), transcript variant 1

Tag N-His
Expression Host E. coli
Neurokinin B (TAC3) (NM_013251) Human Recombinant Protein
TP720967L

USD 1,900.00

3 Weeks

Purified recombinant protein of Human tachykinin 3 (TAC3), transcript variant 1

Tag N-His
Expression Host E. coli
Neurokinin B (TAC3) (NM_013251) Human Recombinant Protein
TP720967M

USD 760.00

3 Weeks

Purified recombinant protein of Human tachykinin 3 (TAC3), transcript variant 1

Tag N-His
Expression Host E. coli
Neurokinin B (TAC3) (NM_013251) Human Recombinant Protein
TP720967XL

USD 2,800.00

3 Weeks

Purified recombinant protein of Human tachykinin 3 (TAC3), transcript variant 1

Tag N-His
Expression Host E. coli
Neurokinin B (TAC3) Cytosection
TS405666

USD 225.00

4 Weeks

Transient overexpression of TAC3 (NM_013251) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Neurokinin B (TAC3) Cytosection
TS405666P5

USD 889.00

4 Weeks

Transient overexpression of TAC3 (NM_013251) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Neurokinin B (TAC3) ICC Control Sections
TS429531P5

USD 889.00

4 Weeks

Transient overexpression of TAC3 (NM_001178054) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack