Products

View as table Download

Rabbit polyclonal TPH2 (Ab-19) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human TPH2 around the phosphorylation site of serine 19 (G-FI-SP-L-D).

Rabbit polyclonal TPH2(Ser19) antibody(Phospho-specific)

Applications WB
Reactivities Human: Ser19, Mouse: Ser19, Rat: Ser19
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human TPH2 around the phosphorylation site of serine 19.
Modifications Phospho-specific

Rabbit polyclonal TPH2 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TPH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-193 amino acids from the Central region of human TPH2.

Rabbit Polyclonal Anti-TPH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPH2 antibody: synthetic peptide directed towards the N terminal of human TPH2. Synthetic peptide located within the following region: REAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSS

Goat Anti-TPH2 (aa16-29) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence RGFSLDSAVPEEHQ-C, from the N Terminus of the protein sequence according to NP_775489.2.

Rabbit Polyclonal Anti-TPH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPH2 antibody: synthetic peptide directed towards the middle region of human TPH2. Synthetic peptide located within the following region: KMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDA

Rabbit Polyclonal Tryptophan hydroxylase 2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the human Tryptophan hydroxylase 2 protein (between residues 1-100) [UniProt Q8IWU9]

Rabbit Polyclonal Tryptophan hydroxylase 2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the human Tryptophan hydroxylase 2 protein (between residues 100-200) [UniProt Q8IWU9]

Rabbit Polyclonal Anti-TPH2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TPH2

Transient overexpression of TPH2 (NM_173353) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of TPH2 (NM_173353) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of TPH2 (NM_173353) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack