UGT2B4 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
UGT2B4 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, UGT2B4 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, UGT2B4 (mGFP-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti-ORF clone of UGT2B4 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, UGT2B4 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of UGT2B4 (mGFP-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, UGT2B4 (mGFP-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
UGT2B4 (myc-DDK-tagged) - Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
UGT2B4 (myc-DDK-tagged) - Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
UGT2B4 (GFP-tagged) - Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
UGT2B4 (untagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti-ORF clone of UGT2B4 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4)
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti-ORF clone of UGT2B4 (mGFP-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4)
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-UGT2B4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT2B4 antibody: synthetic peptide directed towards the N terminal of human UGT2B4. Synthetic peptide located within the following region: NIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFE |
UGT2B4 (GFP-tagged) - Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
UGT2B4 (GFP-tagged) - Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
UGT2B4 (untagged) - Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
UGT2B4 (untagged) - Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-UGT2B4 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UGT2B4 |
Transient overexpression of UGT2B4 (NM_021139) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of UGT2B4 (NM_001297615) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of UGT2B4 (NM_001297616) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of UGT2B4 (NM_021139) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of UGT2B4 (NM_021139) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of UGT2B4 (NM_001297615) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of UGT2B4 (NM_001297616) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack