Products

Proteins (13)
cDNA Clones (12)
Antibodies (4)
Jump to Filters
View as table Download
DLK (DLK1) (NM_003836) Human Tagged ORF Clone
RC202923

USD 420.00

In Stock

DLK1 (Myc-DDK-tagged)-Human delta-like 1 homolog (Drosophila) (DLK1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
DLK (DLK1) (NM_003836) Human Tagged ORF Clone
RG202923

USD 460.00

In Stock

DLK1 (GFP-tagged) - Human delta-like 1 homolog (Drosophila) (DLK1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DLK (DLK1) (NM_003836) Human Recombinant Protein
TP302923

USD 823.00

In Stock

Recombinant protein of human delta-like 1 homolog (Drosophila) (DLK1)

Tag C-Myc/DDK
Expression Host HEK293T
DLK (DLK1) (NM_003836) Human Untagged Clone
SC127962

USD 540.00

In Stock

DLK1 (untagged)-Human delta-like 1 homolog (Drosophila) (DLK1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
DLK (DLK1) (NM_003836) Human Tagged ORF Clone
RC202923L3

USD 620.00

3 Weeks

Lenti ORF clone of Human delta-like 1 homolog (Drosophila) (DLK1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DLK (DLK1) (NM_003836) Human Tagged ORF Clone
RC202923L4

USD 620.00

In Stock

Lenti ORF clone of Human delta-like 1 homolog (Drosophila) (DLK1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DLK (DLK1) (NM_003836) Human Untagged Clone
SC320741

USD 310.00

In Stock

DLK1 (untagged)-Human delta-like 1 homolog (Drosophila) (DLK1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
DLK (DLK1) (NM_003836) Human Tagged ORF Clone
RC202923L1

USD 768.00

In Stock

Lenti ORF clone of Human delta-like 1 homolog (Drosophila) (DLK1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
DLK (DLK1) Rabbit Polyclonal Antibody
AP51272PU-N

USD 450.00

2 Weeks

DLK (DLK1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Recombinant protein of Human DLK
DLK (DLK1) (NM_003836) Human Tagged ORF Clone
RC202923L2

USD 620.00

3 Weeks

Lenti ORF clone of Human delta-like 1 homolog (Drosophila) (DLK1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
DLK (DLK1) (NM_003836) Human Over-expression Lysate
LC401257

USD 121.00

In Stock

DLK1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
DLK (DLK1) Rabbit Polyclonal Antibody
TA319760

USD 430.00

5 Days

Rabbit Polyclonal DLK1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DLK1 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human DLK1.
DLK (DLK1) Rabbit Polyclonal Antibody
TA319058

USD 345.00

3 Weeks

Rabbit polyclonal anti-DLK1 antibody (CT)

Applications WB
Reactivities Human, Mouse, Rat
Immunogen DLK1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human DLK1.
DLK (DLK1) Rabbit Polyclonal Antibody
TA339381

USD 375.00

5 Days

Rabbit Polyclonal Anti-DLK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLK1 antibody: synthetic peptide directed towards the middle region of human DLK1. Synthetic peptide located within the following region: SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT
DLK1 (24-303, His-tag) Human Protein
AR52000PU-N

USD 1,105.00

2 Weeks

DLK1 (24-303, His-tag) human protein, 0.25 mg

Tag His-tag
Expression Host Insect
DLK1 (24-303, His-tag) Human Protein
AR52000PU-S

USD 330.00

2 Weeks

DLK1 (24-303, His-tag) human protein, 50 µg

Tag His-tag
Expression Host Insect
DLK (DLK1) (NM_003836) Human Mass Spec Standard
PH302923

USD 2,055.00

3 Weeks

DLK1 MS Standard C13 and N15-labeled recombinant protein (NP_003827)

Tag C-Myc/DDK
Expression Host HEK293
DLK (DLK1) (NM_003836) ICC Control Block
TB402923

USD 1,070.00

4 Weeks

Transient overexpression of DLK1 (NM_003836) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DLK (DLK1) (NM_003836) Human Recombinant Protein
TP720389

USD 330.00

3 Weeks

Recombinant protein of human delta-like 1 homolog (Drosophila) (DLK1)

Tag C-His
Expression Host HEK293
DLK (DLK1) (NM_003836) Human Recombinant Protein
TP720389L

USD 1,900.00

3 Weeks

Recombinant protein of human delta-like 1 homolog (Drosophila) (DLK1)

Tag C-His
Expression Host HEK293
DLK (DLK1) (NM_003836) Human Recombinant Protein
TP720389M

USD 760.00

3 Weeks

Recombinant protein of human delta-like 1 homolog (Drosophila) (DLK1)

Tag C-His
Expression Host HEK293
DLK (DLK1) (NM_003836) Human Recombinant Protein
TP720389XL

USD 2,800.00

3 Weeks

Recombinant protein of human delta-like 1 homolog (Drosophila) (DLK1)

Tag C-His
Expression Host HEK293
DLK (DLK1) Cytosection
TS402923

USD 225.00

4 Weeks

Transient overexpression of DLK1 (NM_003836) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

DLK (DLK1) Cytosection
TS402923P5

USD 889.00

4 Weeks

Transient overexpression of DLK1 (NM_003836) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack