Products

View as table Download

DLL4 (Myc-DDK-tagged)-Human delta-like 4 (Drosophila) (DLL4)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

DLL4 (GFP-tagged) - Human delta-like 4 (Drosophila) (DLL4)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

DLL4 (untagged)-Human delta-like 4 (Drosophila) (DLL4)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

DLL4 rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Immunogen Synthetic peptide corresponding to the internal region of human DLL4.

Lenti ORF clone of Human delta-like 4 (Drosophila) (DLL4), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, DLL4 (mGFP-tagged) - Human delta-like 4 (Drosophila) (DLL4), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Purified recombinant protein of Human delta-like 4 (Drosophila) (DLL4).

Tag Tag Free
Expression Host HEK293

Lenti ORF particles, DLL4 (Myc-DDK tagged) - Human delta-like 4 (Drosophila) (DLL4), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, DLL4 (mGFP-tagged) - Human delta-like 4 (Drosophila) (DLL4), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

DLL4 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure HEK293 cells derived Recombinant Human sDLL-4 (Cat.-No AR31113PU-N).

Rabbit polyclonal anti-DELTA-4 antibody

Applications IHC, WB
Reactivities Human, partial reactivity to Mouse and Rat
Conjugation Unconjugated
Immunogen Anti-DELTA-4 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Human DELTA-4.

Lenti ORF clone of Human delta-like 4 (Drosophila) (DLL4), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human delta-like 4 (Drosophila) (DLL4), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

DLL4 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure HEK293 cells derived Recombinant Human sDLL-4 (Cat.-No AR31113PU-N).

DLL4 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Immunogen Highly pure recombinant Human sDLL-4.

DLL4 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Immunogen Highly pure recombinant Human sDLL-4.

Biotinylated Anti-Human sDLL-4 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen HEK293 cells derived Recombinant Human sDLL-4

Anti-Human sDLL-4 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen HEK293 cells derived Recombinant Human sDLL-4

Goat Anti-DLL4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence KNTNQKKELEVDC, from the internal region of the protein sequence according to NP_061947.1.

Rabbit polyclonal Anti-DLL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLL4 antibody: synthetic peptide directed towards the N terminal of human DLL4. Synthetic peptide located within the following region: PGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE

Rabbit polyclonal Anti-DLL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLL4 antibody: synthetic peptide directed towards the N terminal of human DLL4. Synthetic peptide located within the following region: QGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHF

Rabbit Polyclonal Anti-DLL4 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DLL4

Transient overexpression of DLL4 (NM_019074) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of DLL4 (NM_019074) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of DLL4 (NM_019074) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack