Germany
Japan
United Kingdom
China
PAX4 (Myc-DDK-tagged)-Human paired box 4 (PAX4)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF particles, PAX4 (Myc-DDK tagged) - Human paired box 4 (PAX4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PAX4 (mGFP-tagged) - Human paired box 4 (PAX4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PAX4 (GFP-tagged) - Human paired box 4 (PAX4)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, PAX4 (Myc-DDK tagged) - Human paired box 4 (PAX4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, PAX4 (mGFP-tagged) - Human paired box 4 (PAX4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human paired box 4 (PAX4), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human paired box 4 (PAX4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
PAX4 (untagged)-Human paired box 4 (PAX4)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human paired box 4 (PAX4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human paired box 4 (PAX4), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Purified recombinant protein of Human paired box 4 (PAX4), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
PAX4 (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the ?-terminal region of human PAX4 Antibody (Center). |
Rabbit Polyclonal Anti-PAX4 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Immunogen | The immunogen for anti-PAX4 antibody: synthetic peptide directed towards the middle region of human PAX4. Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA |
Rabbit Polyclonal Anti-PAX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-PAX4 antibody: synthetic peptide directed towards the N terminal of human PAX4. Synthetic peptide located within the following region: ISRILKVSNGCVSKILGRYYRTGVLEPKGIGGSKPRLATPPVVARIAQLK |
Carrier-free (BSA/glycerol-free) PAX4 mouse monoclonal antibody,clone OTI2F3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PAX4 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PAX4 mouse monoclonal antibody,clone OTI6H4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PAX4 mouse monoclonal antibody,clone OTI2F3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PAX4 mouse monoclonal antibody,clone 2F3, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
PAX4 mouse monoclonal antibody,clone 2F3, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
PAX4 mouse monoclonal antibody,clone OTI2F3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PAX4 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PAX4 mouse monoclonal antibody,clone 3H1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
PAX4 mouse monoclonal antibody,clone 3H1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
PAX4 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PAX4 mouse monoclonal antibody,clone OTI6H4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PAX4 mouse monoclonal antibody,clone 6H4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
PAX4 mouse monoclonal antibody,clone 6H4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
PAX4 mouse monoclonal antibody,clone OTI6H4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of PAX4 (NM_006193) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PAX4 (NM_006193) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PAX4 (NM_006193) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PAX4
Families
- ES Cell Differentiation/IPS