Germany
Japan
United Kingdom
China
IGFBP2 (Myc-DDK-tagged)-Human insulin-like growth factor binding protein 2, 36kDa (IGFBP2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, IGFBP2 (Myc-DDK tagged) - Human insulin-like growth factor binding protein 2, 36kDa (IGFBP2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Recombinant protein of human insulin-like growth factor binding protein 2, 36kDa (IGFBP2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
IGFBP2 (untagged)-Human insulin-like growth factor binding protein 2, 36kDa (IGFBP2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF particles, IGFBP2 (mGFP-tagged) - Human insulin-like growth factor binding protein 2, 36kDa (IGFBP2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
IGFBP2 (GFP-tagged) - Human insulin-like growth factor binding protein 2, 36kDa (IGFBP2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, IGFBP2 (Myc-DDK tagged) - Human insulin-like growth factor binding protein 2, 36kDa (IGFBP2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, IGFBP2 (mGFP-tagged) - Human insulin-like growth factor binding protein 2, 36kDa (IGFBP2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human insulin-like growth factor binding protein 2, 36kDa (IGFBP2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human insulin-like growth factor binding protein 2, 36kDa (IGFBP2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human insulin-like growth factor binding protein 2, 36kDa (IGFBP2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human insulin-like growth factor binding protein 2, 36kDa (IGFBP2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Purified recombinant protein of Human insulin-like growth factor binding protein 2, 36kDa (IGFBP2).
| Tag | Tag Free |
| Expression Host | Hi-5 insect |
IGFBP2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal IGFBP2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IGFBP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the C-terminal region of human IGFBP2. |
Transient overexpression lysate of insulin-like growth factor binding protein 2, 36kDa (IGFBP2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-IBP2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human IGFBP2. |
Rabbit Polyclonal Anti-IGFBP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IGFBP2 Antibody: synthetic peptide directed towards the middle region of human IGFBP2. Synthetic peptide located within the following region: KPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQ |
Rabbit Polyclonal Anti-IGFBP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IGFBP2 Antibody: synthetic peptide directed towards the middle region of human IGFBP2. Synthetic peptide located within the following region: LEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNC |
IGFBP2 MS Standard C13 and N15-labeled recombinant protein (NP_000588)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
USD 420.00
4 Weeks
Transient overexpression of IGFBP2 (NM_000597) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of IGFBP2 (NM_000597) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of IGFBP2 (NM_000597) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- IGFBP2
Families
- Embryonic stem cells