Germany
Japan
United Kingdom
China
F2R (Myc-DDK-tagged)-Human coagulation factor II (thrombin) receptor (F2R)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 820.00
3 Weeks
Lenti ORF particles, F2R (Myc-DDK tagged) - Human coagulation factor II (thrombin) receptor (F2R), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, F2R (mGFP-tagged) - Human coagulation factor II (thrombin) receptor (F2R), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
F2R (GFP-tagged) - Human coagulation factor II (thrombin) receptor (F2R)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
5 Weeks
Lenti ORF particles, F2R (Myc-DDK tagged) - Human coagulation factor II (thrombin) receptor (F2R), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
F2R (untagged)-Human coagulation factor II (thrombin) receptor (F2R)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human coagulation factor II (thrombin) receptor (F2R), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
F2R HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit Polyclonal Anti-Human Protease-activated Receptor-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)KNESGLTEYRLVSINK, corresponding to amino acid residues 61-76 of human PAR-1. Extracellular, N terminal. |
Rabbit Polyclonal Anti-Thrombin Receptor Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Thrombin Receptor Antibody: A synthesized peptide derived from human Thrombin Receptor |
Transient overexpression lysate of coagulation factor II (thrombin) receptor (F2R)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human coagulation factor II (thrombin) receptor (F2R), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal Thrombin Receptor antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Thrombin Receptor. |
Rabbit polyclonal F2R / PAR1 (Cleaved-Ser42) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human PAR1. |
Rabbit Polyclonal Thrombin Receptor Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. In vivo generated recombinant protein fragment. |
(untagged)-Homo sapiens, Similar to coagulation factor II (thrombin) receptor, clone IMAGE:4849569
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Thrombin Receptor (F2R) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-F2R Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2R antibody: synthetic peptide directed towards the N terminal of human F2R. |
Rabbit Polyclonal Anti-F2R Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | F2R / Thrombin Receptor / PAR1 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human Thrombin Receptor. Percent identity with other species by BLAST analysis: Human, Gibbon, Baboon, Monkey (100%); Gorilla (95%). |
Rabbit Polyclonal Anti-F2R Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2R antibody: synthetic peptide directed towards the C terminal of human F2R. Synthetic peptide located within the following region: YAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSSAVANRSKKSRALFLSA |
USD 820.00
3 Weeks
Lenti ORF particles, F2R (mGFP-tagged) - Human coagulation factor II (thrombin) receptor (F2R), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Anti-F2R Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor |
Transient overexpression of F2R (NM_001992) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of F2R (NM_001992) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of F2R (NM_001992) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- F2R
Families
- GPCR