Germany
Japan
United Kingdom
China
GHRHR (Myc-DDK-tagged)-Human growth hormone releasing hormone receptor (GHRHR), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, GHRHR (Myc-DDK tagged) - Human growth hormone releasing hormone receptor (GHRHR), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
GHRHR (Myc-DDK-tagged)-Human growth hormone releasing hormone receptor (GHRHR)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, GHRHR (mGFP-tagged) - Human growth hormone releasing hormone receptor (GHRHR), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
GHRHR (GFP-tagged) - Human growth hormone releasing hormone receptor (GHRHR)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human growth hormone releasing hormone receptor (GHRHR), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GHRHR (Myc-DDK tagged) - Human growth hormone releasing hormone receptor (GHRHR), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human growth hormone releasing hormone receptor (GHRHR), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GHRHR (mGFP-tagged) - Human growth hormone releasing hormone receptor (GHRHR), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human growth hormone releasing hormone receptor (GHRHR), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GHRHR (Myc-DDK tagged) - Human growth hormone releasing hormone receptor (GHRHR), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human growth hormone releasing hormone receptor (GHRHR), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GHRHR (mGFP-tagged) - Human growth hormone releasing hormone receptor (GHRHR), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GHRHR (GFP-tagged) - Human growth hormone releasing hormone receptor (GHRHR), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human growth hormone releasing hormone receptor (GHRHR), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
GHRHR (untagged)-Human growth hormone releasing hormone receptor (GHRHR)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GHRHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GHRHR antibody: synthetic peptide directed towards the N terminal of human GHRHR. Synthetic peptide located within the following region: VTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEE |
Rabbit Polyclonal Anti-GHRHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GHRHR antibody: synthetic peptide directed towards the middle region of human GHRHR. Synthetic peptide located within the following region: PYPVACPVPLELLAEEESYFSTVKIIYTVGHSISIVALFVAITILVALRR |
Rabbit Polyclonal Anti-GHRHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GHRHR antibody: synthetic peptide directed towards the C terminal of human GHRHR. Synthetic peptide located within the following region: YWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGSLHTQSQYWYCVFV |
Lenti ORF clone of Human growth hormone releasing hormone receptor (GHRHR), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of growth hormone releasing hormone receptor (GHRHR), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-GHRHR Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GHRHR antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human GHRHR. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Marmoset, Panda, Dog (94%); Zebu, Bovine (89%); Rabbit, Pig (83%). |
Rabbit Polyclonal Anti-GHRHR Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GHRHR antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human GHRHR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Elephant (94%); Panda, Bat, Horse, Pig (88%); Marmoset, Zebu, Bovine, Dog (81%). |
Rabbit Polyclonal Anti-GHRHR Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GHRHR antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GHRHR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Hamster, Elephant, Zebu, Rabbit, Pig (94%); Panda, Bovine, Dog, Horse (88%). |
GHRHR HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GHRHR (untagged)-Human growth hormone releasing hormone receptor (GHRHR), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of GHRHR (NM_001009824) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GHRHR (NM_000823) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GHRHR (NM_001009824) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GHRHR (NM_001009824) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GHRHR (NM_000823) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GHRHR
Families
- GPCR