Products

cDNA Clones (27)
Proteins (19)
Antibodies (5)
Jump to Filters
View as table Download
GPR161 (NM_153832) Human Tagged ORF Clone
RC215665

USD 420.00

In Stock

GPR161 (Myc-DDK-tagged)-Human G protein-coupled receptor 161 (GPR161), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GPR161 (NM_001267609) Human Tagged ORF Clone
RG234416

USD 530.00

In Stock

GPR161 (GFP-tagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR161 (NM_001267611) Human Tagged ORF Clone
RC238839

USD 480.00

In Stock

GPR161 (myc-DDK-tagged) - Human G protein-coupled receptor 161 (GPR161), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR161 (NM_153832) Human Tagged ORF Clone
RG215665

USD 460.00

In Stock

GPR161 (GFP-tagged) - Human G protein-coupled receptor 161 (GPR161), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR161 (NM_001267610) Human Tagged ORF Clone
RC234362

USD 420.00

In Stock

GPR161 (Myc-DDK tagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR161 (NM_153832) Human Tagged ORF Clone
RC215665L3

USD 620.00

3 Weeks

Lenti-ORF clone of GPR161 (Myc-DDK-tagged)-Human G protein-coupled receptor 161 (GPR161), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR161 (NM_153832) Human Tagged ORF Clone Lentiviral Particle
RC215665L3V

USD 820.00

6 Weeks

Lenti ORF particles, GPR161 (Myc-DDK-tagged)-Human G protein-coupled receptor 161 (GPR161), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR161 (NM_153832) Human Tagged ORF Clone
RC215665L4

USD 620.00

3 Weeks

Lenti-ORF clone of GPR161 (mGFP-tagged)-Human G protein-coupled receptor 161 (GPR161), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR161 (NM_153832) Human Tagged ORF Clone Lentiviral Particle
RC215665L4V

USD 820.00

6 Weeks

Lenti ORF particles, GPR161 (mGFP-tagged)-Human G protein-coupled receptor 161 (GPR161), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR161 (NM_001267612) Human Tagged ORF Clone
RC232654

USD 420.00

3 Weeks

GPR161 (Myc-DDK tagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR161 (NM_001267614) Human Tagged ORF Clone
RC232681

USD 420.00

3 Weeks

GPR161 (Myc-DDK tagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR161 (NM_001267613) Human Tagged ORF Clone
RC232766

USD 420.00

3 Weeks

GPR161 (Myc-DDK tagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR161 (NM_001267609) Human Tagged ORF Clone
RC234416

USD 480.00

2 Weeks

GPR161 (Myc-DDK tagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR161 (NM_001267612) Human Tagged ORF Clone
RG232654

USD 460.00

3 Weeks

GPR161 (GFP-tagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR161 (NM_001267614) Human Tagged ORF Clone
RG232681

USD 460.00

3 Weeks

GPR161 (GFP-tagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR161 (NM_001267613) Human Tagged ORF Clone
RG232766

USD 460.00

3 Weeks

GPR161 (GFP-tagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR161 (NM_001267610) Human Tagged ORF Clone
RG234362

USD 460.00

3 Weeks

GPR161 (GFP-tagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR161 (NM_153832) Human Untagged Clone
SC100531

USD 310.00

2 Weeks

GPR161 (untagged)-Human G protein-coupled receptor 161 (GPR161), transcript variant 3

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
GPR161 Rabbit Polyclonal Antibody
TA346460

USD 475.00

5 Days

Rabbit Polyclonal Anti-GPR161 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the middle region of human GPR161. Synthetic peptide located within the following region: SISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLE
GPR161 Rabbit Polyclonal Antibody
TA346458

USD 410.00

5 Days

Rabbit Polyclonal Anti-GPR161 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the N terminal of human GPR161. Synthetic peptide located within the following region: MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVV
GPR161 Rabbit Polyclonal Antibody
TA346459

USD 475.00

5 Days

Rabbit Polyclonal Anti-GPR161 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the middle region of human GPR161. Synthetic peptide located within the following region: FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG
GPR161 (NM_153832) Human Untagged Clone
SC108456

USD 780.00

In Stock

GPR161 (untagged)-Human G protein-coupled receptor 161 (GPR161), transcript variant 3

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
GPR161 (NM_001267611) Human Untagged Clone
SC336733

USD 550.00

In Stock

GPR161 (untagged) - Human G protein-coupled receptor 161 (GPR161), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
GPR161 (AK091271) Human Untagged Clone
SC103124

USD 660.00

In Stock

(untagged)-Human cDNA FLJ33952 fis, clone CTONG2018614

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
GPR161 Rabbit Polyclonal Antibody
TA316813

USD 425.00

5 Days

GPR161 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Hamster, Human, Monkey
Immunogen GPR161 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human GPR161. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Hamster (100%); Panda, Dog, Horse, Rabbit (95%); Mouse, Elephant, Bat, Pig, Opossum, Turkey, Chicken (89%).
GPR161 Rabbit Polyclonal Antibody
TA329510

USD 310.00

5 Days

Rabbit Polyclonal anti-GPR161 antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the C terminal of human GPR161. Synthetic peptide located within the following region: INLFGEEALPGVLVTARTVPGGGFGGRRGSRTLVSQRLQLQSIEEGDVLA
GPR161 (NM_153832) Human Over-expression Lysate
LC403522

USD 121.00

2 Weeks

GPR161 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GPR161 (NM_153832) Human Over-expression Lysate
LY403522

USD 396.00

5 Days

Transient overexpression lysate of G protein-coupled receptor 161 (GPR161), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GPR161 (NM_001267611) Human Tagged ORF Clone
RG238839

USD 520.00

2 Weeks

GPR161 (GFP-tagged) - Human G protein-coupled receptor 161 (GPR161), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR161 (NM_001267612) Human Untagged Clone
SC330770

USD 400.00

3 Weeks

GPR161 (untagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 5

Vector pCMV6 series
Tag Tag Free
GPR161 (NM_001267613) Human Untagged Clone
SC330771

USD 460.00

3 Weeks

GPR161 (untagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 6

Vector pCMV6 series
Tag Tag Free
GPR161 (NM_001267614) Human Untagged Clone
SC330772

USD 410.00

3 Weeks

GPR161 (untagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 7

Vector pCMV6 series
Tag Tag Free
GPR161 (NM_001267609) Human Untagged Clone
SC332867

USD 570.00

5 Weeks

GPR161 (untagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 1

Vector pCMV6 series
Tag Tag Free
GPR161 (NM_001267610) Human Untagged Clone
SC332868

USD 540.00

5 Weeks

GPR161 (untagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 2

Vector pCMV6 series
Tag Tag Free
GPR161 (NM_153832) ICC Control Block
TB415665

USD 1,070.00

4 Weeks

Transient overexpression of GPR161 (NM_153832) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GPR161 (NM_001267612) ICC Control Block
TB432654

USD 1,070.00

4 Weeks

Transient overexpression of GPR161 (NM_001267612) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GPR161 (NM_001267614) ICC Control Block
TB432681

USD 1,070.00

4 Weeks

Transient overexpression of GPR161 (NM_001267614) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GPR161 (NM_001267613) ICC Control Block
TB432766

USD 1,070.00

4 Weeks

Transient overexpression of GPR161 (NM_001267613) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GPR161 (NM_001267610) ICC Control Block
TB434362

USD 1,070.00

4 Weeks

Transient overexpression of GPR161 (NM_001267610) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GPR161 (NM_001267609) ICC Control Block
TB434416

USD 1,130.00

4 Weeks

Transient overexpression of GPR161 (NM_001267609) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GPR161 (NM_001267611) ICC Control Block
TB438839

USD 1,130.00

4 Weeks

Transient overexpression of GPR161 (NM_001267611) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GPR161 Cytosection
TS415665

USD 225.00

4 Weeks

Transient overexpression of GPR161 (NM_153832) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GPR161 Cytosection
TS415665P5

USD 889.00

4 Weeks

Transient overexpression of GPR161 (NM_153832) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GPR161 ICC Control Sections
TS432654P5

USD 889.00

4 Weeks

Transient overexpression of GPR161 (NM_001267612) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GPR161 ICC Control Sections
TS432681P5

USD 889.00

4 Weeks

Transient overexpression of GPR161 (NM_001267614) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GPR161 ICC Control Sections
TS432766P5

USD 889.00

4 Weeks

Transient overexpression of GPR161 (NM_001267613) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GPR161 Cytosection
TS434362

USD 225.00

4 Weeks

Transient overexpression of GPR161 (NM_001267610) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GPR161 Cytosection
TS434362P5

USD 889.00

4 Weeks

Transient overexpression of GPR161 (NM_001267610) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GPR161 ICC Control Sections
TS434416P5

USD 889.00

4 Weeks

Transient overexpression of GPR161 (NM_001267609) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GPR161 Cytosection
TS438839

USD 225.00

4 Weeks

Transient overexpression of GPR161 (NM_001267611) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack