Germany
Japan
United Kingdom
China
GPR161 (Myc-DDK-tagged)-Human G protein-coupled receptor 161 (GPR161), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Gpr161 (Myc-DDK-tagged) - Mouse G protein-coupled receptor 161 (Gpr161)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR161 (GFP-tagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR161 (myc-DDK-tagged) - Human G protein-coupled receptor 161 (GPR161), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR161 (GFP-tagged) - Human G protein-coupled receptor 161 (GPR161), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR161 (Myc-DDK tagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR161 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN415665 is the updated version of KN215665.
Gpr161 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN507217 is the updated version of KN307217.
Gpr161 (GFP-tagged) - Mouse G protein-coupled receptor 161 (Gpr161), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Gpr161 (Myc-DDK-tagged) - Mouse G protein-coupled receptor 161 (Gpr161)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gpr161 (Myc-DDK-tagged) - Mouse G protein-coupled receptor 161 (Gpr161), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gpr161 (mGFP-tagged) - Mouse G protein-coupled receptor 161 (Gpr161)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gpr161 (GFP-tagged) - Mouse G protein-coupled receptor 161 (Gpr161), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GPR161 (Myc-DDK-tagged)-Human G protein-coupled receptor 161 (GPR161), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPR161 (Myc-DDK-tagged)-Human G protein-coupled receptor 161 (GPR161), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GPR161 (mGFP-tagged)-Human G protein-coupled receptor 161 (GPR161), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPR161 (mGFP-tagged)-Human G protein-coupled receptor 161 (GPR161), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GPR161 (Myc-DDK tagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR161 (Myc-DDK tagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 7
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR161 (Myc-DDK tagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 6
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR161 (Myc-DDK tagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR161 (GFP-tagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR161 (GFP-tagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 7
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR161 (GFP-tagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 6
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR161 (GFP-tagged) - Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR161 (untagged)-Human G protein-coupled receptor 161 (GPR161), transcript variant 3
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GPR161 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the middle region of human GPR161. Synthetic peptide located within the following region: SISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLE |
Rabbit Polyclonal Anti-GPR161 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the N terminal of human GPR161. Synthetic peptide located within the following region: MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVV |
Rabbit Polyclonal Anti-GPR161 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the middle region of human GPR161. Synthetic peptide located within the following region: FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG |
Gpr161 (untagged) - Mouse G protein-coupled receptor 161 (Gpr161), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
GPR161 (untagged)-Human G protein-coupled receptor 161 (GPR161), transcript variant 3
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
GPR161 (untagged) - Human G protein-coupled receptor 161 (GPR161), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
GPR161 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
(untagged)-Human cDNA FLJ33952 fis, clone CTONG2018614
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
GPR161 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Hamster, Human, Monkey |
| Immunogen | GPR161 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human GPR161. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Hamster (100%); Panda, Dog, Horse, Rabbit (95%); Mouse, Elephant, Bat, Pig, Opossum, Turkey, Chicken (89%). |
Rabbit Polyclonal anti-GPR161 antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the C terminal of human GPR161. Synthetic peptide located within the following region: INLFGEEALPGVLVTARTVPGGGFGGRRGSRTLVSQRLQLQSIEEGDVLA |
GPR161 CRISPRa kit - CRISPR gene activation of human G protein-coupled receptor 161
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Gpr161 CRISPRa kit - CRISPR gene activation of mouse G protein-coupled receptor 161
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene GPR161
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene GPR161
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene GPR161
GPR161 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
GPR161 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
GPR161 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | RFP-BSD |
GPR161 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of G protein-coupled receptor 161 (GPR161), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
qSTAR qPCR primer pairs against Mus musculus gene Gpr161
GPR161 (GFP-tagged) - Human G protein-coupled receptor 161 (GPR161), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
3`UTR clone of G protein-coupled receptor 161 (GPR161) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Active filters
Target Symbol
- GPR161