Products

cDNA Clones (22)
Proteins (6)
Antibodies (5)
Jump to Filters
View as table Download
GPR34 (NM_005300) Human Tagged ORF Clone
RG204677

USD 460.00

In Stock

GPR34 (GFP-tagged) - Human G protein-coupled receptor 34 (GPR34), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR34 (NM_001097579) Human Tagged ORF Clone
RC223795

USD 420.00

In Stock

GPR34 (Myc-DDK-tagged)-Human G protein-coupled receptor 34 (GPR34), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR34 (NM_005300) Human Tagged ORF Clone
RC204677

USD 420.00

In Stock

GPR34 (Myc-DDK-tagged)-Human G protein-coupled receptor 34 (GPR34), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR34 (NM_005300) Human Tagged ORF Clone Lentiviral Particle
RC204677L1V

USD 820.00

3 Weeks

Lenti ORF particles, GPR34 (Myc-DDK tagged) - Human G protein-coupled receptor 34 (GPR34), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GPR34 (NM_005300) Human Tagged ORF Clone Lentiviral Particle
RC204677L2V

USD 820.00

6 Weeks

Lenti ORF particles, GPR34 (mGFP-tagged) - Human G protein-coupled receptor 34 (GPR34), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GPR34 (NM_001097579) Human Tagged ORF Clone Lentiviral Particle
RC223795L1V

USD 820.00

3 Weeks

Lenti ORF particles, GPR34 (Myc-DDK tagged) - Human G protein-coupled receptor 34 (GPR34), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GPR34 (NM_001097579) Human Tagged ORF Clone Lentiviral Particle
RC223795L2V

USD 820.00

6 Weeks

Lenti ORF particles, GPR34 (mGFP-tagged) - Human G protein-coupled receptor 34 (GPR34), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GPR34 (NM_005300) Human Untagged Clone
SC116807

USD 310.00

In Stock

GPR34 (untagged)-Human G protein-coupled receptor 34 (GPR34), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
GPR34 (NM_005300) Human Tagged ORF Clone
RC204677L3

USD 620.00

3 Weeks

Lenti ORF clone of Human G protein-coupled receptor 34 (GPR34), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR34 (NM_005300) Human Tagged ORF Clone Lentiviral Particle
RC204677L3V

USD 820.00

5 Weeks

Lenti ORF particles, GPR34 (Myc-DDK tagged) - Human G protein-coupled receptor 34 (GPR34), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR34 (NM_005300) Human Tagged ORF Clone
RC204677L4

USD 620.00

3 Weeks

Lenti ORF clone of Human G protein-coupled receptor 34 (GPR34), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR34 (NM_005300) Human Tagged ORF Clone Lentiviral Particle
RC204677L4V

USD 820.00

7 Weeks

Lenti ORF particles, GPR34 (mGFP-tagged) - Human G protein-coupled receptor 34 (GPR34), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR34 (NM_001097579) Human Tagged ORF Clone
RC223795L3

USD 620.00

3 Weeks

Lenti ORF clone of Human G protein-coupled receptor 34 (GPR34), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR34 (NM_001097579) Human Tagged ORF Clone Lentiviral Particle
RC223795L3V

USD 820.00

6 Weeks

Lenti ORF particles, GPR34 (Myc-DDK tagged) - Human G protein-coupled receptor 34 (GPR34), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR34 (NM_001097579) Human Tagged ORF Clone
RC223795L4

USD 620.00

3 Weeks

Lenti ORF clone of Human G protein-coupled receptor 34 (GPR34), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR34 (NM_001097579) Human Tagged ORF Clone Lentiviral Particle
RC223795L4V

USD 820.00

6 Weeks

Lenti ORF particles, GPR34 (mGFP-tagged) - Human G protein-coupled receptor 34 (GPR34), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR34 (NM_001097579) Human Tagged ORF Clone
RG223795

USD 460.00

3 Weeks

GPR34 (GFP-tagged) - Human G protein-coupled receptor 34 (GPR34), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR34 (NM_005300) Human Tagged ORF Clone
RC204677L1

USD 768.00

In Stock

Lenti ORF clone of Human G protein-coupled receptor 34 (GPR34), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GPR34 Rabbit Polyclonal Antibody
TA313952

USD 345.00

In Stock

Rabbit polyclonal anti-GPR34 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR34.
GPR34 (NM_005300) Human Tagged ORF Clone
RC204677L2

USD 620.00

3 Weeks

Lenti ORF clone of Human G protein-coupled receptor 34 (GPR34), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GPR34 (NM_001097579) Human Tagged ORF Clone
RC223795L1

USD 620.00

In Stock

Lenti ORF clone of Human G protein-coupled receptor 34 (GPR34), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GPR34 (NM_001097579) Human Tagged ORF Clone
RC223795L2

USD 620.00

3 Weeks

Lenti ORF clone of Human G protein-coupled receptor 34 (GPR34), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GPR34 (Center) Rabbit Polyclonal Antibody
AP51926PU-N

USD 450.00

2 Weeks

GPR34 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 239-269aa) of human GPR34.
GPR34 Rabbit Polyclonal Antibody
TA338154

USD 375.00

5 Days

Rabbit Polyclonal Anti-GPR34 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR34 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR34. Synthetic peptide located within the following region: KGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNL
GPR34 Rabbit Polyclonal Antibody
TA338155

USD 375.00

5 Days

Rabbit Polyclonal Anti-GPR34 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR34 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR34. Synthetic peptide located within the following region: SFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLH
GPR34 Rabbit Polyclonal Antibody
TA340804

USD 425.00

5 Days

Rabbit Polyclonal Anti-GPR34 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Immunogen GPR34 antibody was raised against synthetic 17 amino acid peptide from 2nd cytoplasmic domain of human GPR34. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Bovine, Horse (100%); Marmoset, Mouse, Rat, Elephant, Guinea pig (94%); Panda (88%); Bat, Opossum (82%).
GPR34 (NM_001097579) Human Untagged Clone
SC316196

USD 650.00

3 Weeks

GPR34 (untagged)-Human G protein-coupled receptor 34 (GPR34), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
GPR34 ICC Control Block
TB404677

USD 1,070.00

4 Weeks

Transient overexpression of GPR34 (NM_005300) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GPR34 ICC Control Block
TB423795

USD 1,070.00

4 Weeks

Transient overexpression of GPR34 (NM_001097579) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GPR34 Cytosection
TS404677

USD 225.00

4 Weeks

Transient overexpression of GPR34 (NM_005300) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GPR34 Cytosection
TS404677P5

USD 889.00

4 Weeks

Transient overexpression of GPR34 (NM_005300) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GPR34 Cytosection
TS423795

USD 225.00

4 Weeks

Transient overexpression of GPR34 (NM_001097579) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GPR34 Cytosection
TS423795P5

USD 889.00

4 Weeks

Transient overexpression of GPR34 (NM_001097579) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack