Germany
Japan
United Kingdom
China
P2RY10 (Myc-DDK-tagged)-Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
P2RY10 (Myc-DDK-tagged)-Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
P2RY10 (GFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
P2RY10 (GFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, P2RY10 (Myc-DDK tagged) - Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, P2RY10 (mGFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, P2RY10 (Myc-DDK tagged) - Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, P2RY10 (mGFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
P2RY10 (untagged)-Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
P2RY10 (untagged)-Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
P2Y10 / P2RY10 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | P2Y10 / P2RY10 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human P2RY10 / P2Y10. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%). |
P2Y10 / P2RY10 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Hamster, Human, Monkey |
| Immunogen | P2Y10 / P2RY10 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human P2RY10 / P2Y10. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Hamster (100%); Gibbon, Mouse, Rat, Panda, Bat, Bovine, Rabbit, Horse (94%); Marmoset, Elephant, Dog, Opossum (89%). |
Rabbit Polyclonal Anti-P2RY10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-P2RY10 Antibody is: synthetic peptide directed towards the N-terminal region of Human P2RY10. Synthetic peptide located within the following region: NLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLAN |
P2RY10 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
P2RY10 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
P2RY10 (untagged)-Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of P2RY10 (NM_014499) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of P2RY10 (NM_198333) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of P2RY10 (NM_014499) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of P2RY10 (NM_014499) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of P2RY10 (NM_198333) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of P2RY10 (NM_198333) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- P2RY10
Families
- GPCR