Germany
Japan
United Kingdom
China
P2RY10 (Myc-DDK-tagged)-Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
P2RY10 (Myc-DDK-tagged)-Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
P2RY10 (GFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
P2RY10 (GFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
P2ry10 (Myc-DDK-tagged) - Mouse purinergic receptor P2Y, G-protein coupled 10 (P2ry10)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
P2RY10 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN408706 is the updated version of KN208706.
P2ry10 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN512716 is the updated version of KN312716.
P2ry10 (GFP-tagged) - Mouse purinergic receptor P2Y, G-protein coupled 10 (P2ry10)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of P2ry10 (Myc-DDK-tagged) - Mouse purinergic receptor P2Y, G-protein coupled 10 (P2ry10)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, P2ry10 (Myc-DDK-tagged) - Mouse purinergic receptor P2Y, G-protein coupled 10 (P2ry10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of P2ry10 (mGFP-tagged) - Mouse purinergic receptor P2Y, G-protein coupled 10 (P2ry10)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, P2ry10 (GFP-tagged) - Mouse purinergic receptor P2Y, G-protein coupled 10 (P2ry10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, P2RY10 (Myc-DDK tagged) - Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, P2RY10 (mGFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, P2RY10 (Myc-DDK tagged) - Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, P2RY10 (mGFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
P2ry10 (myc-DDK-tagged) - Rat purinergic receptor P2Y, G-protein coupled, 10 (P2ry10)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
P2RY10 (untagged)-Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
P2ry10 (untagged) - Rat purinergic receptor P2Y, G-protein coupled, 10 (P2ry10)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
P2ry10 (untagged) - Mouse purinergic receptor P2Y, G-protein coupled 10 (P2ry10), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
P2RY10 (untagged)-Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
P2Y10 / P2RY10 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | P2Y10 / P2RY10 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human P2RY10 / P2Y10. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%). |
P2Y10 / P2RY10 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Hamster, Human, Monkey |
| Immunogen | P2Y10 / P2RY10 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human P2RY10 / P2Y10. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Hamster (100%); Gibbon, Mouse, Rat, Panda, Bat, Bovine, Rabbit, Horse (94%); Marmoset, Elephant, Dog, Opossum (89%). |
Rabbit Polyclonal Anti-P2RY10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-P2RY10 Antibody is: synthetic peptide directed towards the N-terminal region of Human P2RY10. Synthetic peptide located within the following region: NLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLAN |
P2RY10 CRISPRa kit - CRISPR gene activation of human P2Y receptor family member 10
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
P2ry10 CRISPRa kit - CRISPR gene activation of mouse purinergic receptor P2Y, G-protein coupled 10
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene P2RY10
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene P2RY10
P2RY10 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
P2RY10 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene P2ry10
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene P2ry10
3`UTR clone of purinergic receptor P2Y G-protein coupled 10 (P2RY10) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of purinergic receptor P2Y G-protein coupled 10 (P2RY10) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
P2RY10 (untagged)-Human purinergic receptor P2Y, G-protein coupled, 10 (P2RY10), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
P2ry10 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
P2RY10 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human P2RY10 (NP_001311147.1). |
| Modifications | Unmodified |
Transient overexpression of P2RY10 (NM_014499) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of P2RY10 (NM_198333) in HEK293T cells paraffin embedded controls for ICC/IHC staining
P2RY10 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
P2RY10 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
P2ry10 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
P2ry10 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
P2RY10 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Active filters
Target Symbol
- P2RY10