Products

View as table Download

SOX7 (Myc-DDK-tagged)-Human SRY (sex determining region Y)-box 7 (SOX7)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, SOX7 (Myc-DDK tagged) - Human SRY (sex determining region Y)-box 7 (SOX7), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, SOX7 (mGFP-tagged) - Human SRY (sex determining region Y)-box 7 (SOX7), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

SOX7 (GFP-tagged) - Human SRY (sex determining region Y)-box 7 (SOX7)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human SRY (sex determining region Y)-box 7 (SOX7), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SOX7 (Myc-DDK tagged) - Human SRY (sex determining region Y)-box 7 (SOX7), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human SRY (sex determining region Y)-box 7 (SOX7), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SOX7 (mGFP-tagged) - Human SRY (sex determining region Y)-box 7 (SOX7), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

SOX7 (untagged)-Human SRY (sex determining region Y)-box 7 (SOX7)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human SRY (sex determining region Y)-box 7 (SOX7), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-SOX7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SOX7 antibody: synthetic peptide directed towards the middle region of human SOX7. Synthetic peptide located within the following region: LLGDMDRNEFDQYLNTPGHPDSATGAMALSGHVPVSQVTPTGPTETSLIS

Lenti ORF clone of Human SRY (sex determining region Y)-box 7 (SOX7), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

SOX7 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of SRY (sex determining region Y)-box 7 (SOX7)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Recombinant protein of human SRY (sex determining region Y)-box 7 (SOX7), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli

Rabbit Polyclonal Anti-SOX7 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SOX7 antibody: synthetic peptide directed towards the N terminal of mouse SOX7. Synthetic peptide located within the following region: LGAYPWTEGLECPALEAELSDGLSPPAVPRPSGDKSSESRIRRPMNAFMV

Anti-SOX7 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 268-388 amino acids of human SRY (sex determining region Y)-box 7

Anti-SOX7 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 268-388 amino acids of human SRY (sex determining region Y)-box 7

Transient overexpression of SOX7 (NM_031439) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of SOX7 (NM_031439) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of SOX7 (NM_031439) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack