SOX7 (Myc-DDK-tagged)-Human SRY (sex determining region Y)-box 7 (SOX7)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SOX7 (Myc-DDK-tagged)-Human SRY (sex determining region Y)-box 7 (SOX7)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, SOX7 (Myc-DDK tagged) - Human SRY (sex determining region Y)-box 7 (SOX7), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, SOX7 (mGFP-tagged) - Human SRY (sex determining region Y)-box 7 (SOX7), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
SOX7 (GFP-tagged) - Human SRY (sex determining region Y)-box 7 (SOX7)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human SRY (sex determining region Y)-box 7 (SOX7), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SOX7 (Myc-DDK tagged) - Human SRY (sex determining region Y)-box 7 (SOX7), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human SRY (sex determining region Y)-box 7 (SOX7), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SOX7 (mGFP-tagged) - Human SRY (sex determining region Y)-box 7 (SOX7), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
SOX7 (untagged)-Human SRY (sex determining region Y)-box 7 (SOX7)
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human SRY (sex determining region Y)-box 7 (SOX7), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-SOX7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SOX7 antibody: synthetic peptide directed towards the middle region of human SOX7. Synthetic peptide located within the following region: LLGDMDRNEFDQYLNTPGHPDSATGAMALSGHVPVSQVTPTGPTETSLIS |
Lenti ORF clone of Human SRY (sex determining region Y)-box 7 (SOX7), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
SOX7 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of SRY (sex determining region Y)-box 7 (SOX7)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Recombinant protein of human SRY (sex determining region Y)-box 7 (SOX7), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Rabbit Polyclonal Anti-SOX7 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SOX7 antibody: synthetic peptide directed towards the N terminal of mouse SOX7. Synthetic peptide located within the following region: LGAYPWTEGLECPALEAELSDGLSPPAVPRPSGDKSSESRIRRPMNAFMV |
Anti-SOX7 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 268-388 amino acids of human SRY (sex determining region Y)-box 7 |
Anti-SOX7 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 268-388 amino acids of human SRY (sex determining region Y)-box 7 |
Transient overexpression of SOX7 (NM_031439) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SOX7 (NM_031439) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SOX7 (NM_031439) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack