Products

Proteins (8)
cDNA Clones (8)
Antibodies (1)
Jump to Filters
View as table Download
CACNA1I (NM_021096) Human Tagged ORF Clone
RC219179

USD 1,999.00

In Stock

CACNA1I (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, T type, alpha 1I subunit (CACNA1I), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNA1I (NM_021096) Human Tagged ORF Clone Lentiviral Particle
RC219179L1V

USD 2,399.00

3 Weeks

Lenti ORF particles, CACNA1I (Myc-DDK tagged) - Human calcium channel, voltage-dependent, T type, alpha 1I subunit (CACNA1I), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CACNA1I (NM_001003406) Human Tagged ORF Clone
RC219238

USD 1,999.00

In Stock

CACNA1I (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, T type, alpha 1I subunit (CACNA1I), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNA1I (NM_021096) Human Tagged ORF Clone
RG219179

USD 2,200.00

3 Weeks

CACNA1I (GFP-tagged) - Human calcium channel, voltage-dependent, T type, alpha 1I subunit (CACNA1I), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNA1I (NM_001003406) Human Tagged ORF Clone
RG219238

USD 2,200.00

3 Weeks

CACNA1I (GFP-tagged) - Human calcium channel, voltage-dependent, T type, alpha 1I subunit (CACNA1I), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNA1I (NM_021096) Human Tagged Lenti ORF Clone
RC219179L1

USD 2,724.00

In Stock

Lenti ORF clone of Human calcium channel, voltage-dependent, T type, alpha 1I subunit (CACNA1I), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CACNA1I (NM_021096) Human Untagged Clone
SC304909

USD 4,500.00

In Stock

CACNA1I (untagged)-Human calcium channel, voltage-dependent, T type, alpha 1I subunit (CACNA1I), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CACNA1I (NM_021096) Human Over-expression Lysate
LY412086

USD 605.00

In Stock

Transient overexpression lysate of calcium channel, voltage-dependent, T type, alpha 1I subunit (CACNA1I), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CACNA1I Rabbit Polyclonal Antibody
TA338596

USD 375.00

5 Days

Rabbit Polyclonal Anti-CACNA1I Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNA1I antibody: synthetic peptide directed towards the middle region of human CACNA1I. Synthetic peptide located within the following region: LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAS
CACNA1I (NM_021096) Human Over-expression Lysate
LC412086

USD 187.00

2 Weeks

CACNA1I HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CACNA1I (NM_001003406) Human Untagged Clone
SC300498

USD 4,440.00

Please Inquire

CACNA1I (untagged)-Human calcium channel, voltage-dependent, T type, alpha 1I subunit (CACNA1I), transcript variant 2

Vector pCMV6 series
Tag Tag Free
CACNA1I (NM_021096) ICC Control Block
TB419179

USD 2,649.00

4 Weeks

Transient overexpression of CACNA1I (NM_021096) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CACNA1I (NM_001003406) ICC Control Block
TB419238

USD 2,649.00

4 Weeks

Transient overexpression of CACNA1I (NM_001003406) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CACNA1I Cytosection
TS419179

USD 225.00

4 Weeks

Transient overexpression of CACNA1I (NM_021096) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CACNA1I Cytosection
TS419179P5

USD 889.00

4 Weeks

Transient overexpression of CACNA1I (NM_021096) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CACNA1I Cytosection
TS419238

USD 225.00

4 Weeks

Transient overexpression of CACNA1I (NM_001003406) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CACNA1I Cytosection
TS419238P5

USD 889.00

4 Weeks

Transient overexpression of CACNA1I (NM_001003406) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack