CACNA1I Rabbit Polyclonal Antibody

CAT#: TA338596

Rabbit Polyclonal Anti-CACNA1I Antibody

Product Images

WB Suggested Anti-CACNA1I Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CACNA1I antibody: synthetic peptide directed towards the middle region of human CACNA1I. Synthetic peptide located within the following region: LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 245 kDa
• Gene Name: calcium voltage-gated channel subunit alpha1 I
• Database Link:
  NP_001003406
  Entrez Gene 8911 Human
  UniProt ID Q9P0X4
• Background: This gene encodes the pore-forming alpha subunit of a voltage gated calcium channel. The encoded protein is a member of a subfamily of calcium channels referred to as is a low voltage-activated, T-type, calcium channel. The channel encoded by this protein is characterized by a slower activation and inactivation compared to other T-type calcium channels. This protein may be involved in calcium signaling in neurons. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2011]
• Synonyms: ca(v)3.3; Cav3.3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 92%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Calcium, Transmembrane
• Protein Pathways: Calcium signaling pathway, MAPK signaling pathway