Products

cDNA Clones (21)
Proteins (10)
Antibodies (6)
Jump to Filters
View as table Download
alpha 1 Glycine Receptor (GLRA1) (NM_000171) Human Tagged ORF Clone
RG210390

USD 460.00

In Stock

GLRA1 (GFP-tagged) - Human glycine receptor, alpha 1 (GLRA1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
alpha 1 Glycine Receptor (GLRA1) (NM_000171) Human Tagged ORF Clone Lentiviral Particle
RC210390L3V

USD 820.00

6 Weeks

Lenti ORF particles, GLRA1 (Myc-DDK tagged) - Human glycine receptor, alpha 1 (GLRA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
alpha 1 Glycine Receptor (GLRA1) (NM_000171) Human Tagged ORF Clone Lentiviral Particle
RC210390L4V

USD 820.00

6 Weeks

Lenti ORF particles, GLRA1 (mGFP-tagged) - Human glycine receptor, alpha 1 (GLRA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
alpha 1 Glycine Receptor (GLRA1) (NM_001146040) Human Tagged ORF Clone Lentiviral Particle
RC228907L3V

USD 820.00

6 Weeks

Lenti ORF particles, GLRA1 (Myc-DDK-tagged)-Human glycine receptor, alpha 1 (GLRA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
alpha 1 Glycine Receptor (GLRA1) (NM_001146040) Human Tagged ORF Clone Lentiviral Particle
RC228907L4V

USD 820.00

6 Weeks

Lenti ORF particles, GLRA1 (mGFP-tagged)-Human glycine receptor, alpha 1 (GLRA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
alpha 1 Glycine Receptor (GLRA1) (NM_000171) Human Untagged Clone
SC310373

USD 760.00

In Stock

GLRA1 (untagged)-Human glycine receptor, alpha 1 (GLRA1), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SC310373 is the updated version of SC123992.
alpha 1 Glycine Receptor (GLRA1) Rabbit Polyclonal Antibody
TA327455

USD 275.00

3 Weeks

Rabbit anti-GLRA1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human GLRA1
alpha 1 Glycine Receptor (GLRA1) (NM_000171) Human Over-expression Lysate
LY400062

USD 396.00

5 Days

Transient overexpression lysate of glycine receptor, alpha 1 (GLRA1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
alpha 1 Glycine Receptor (GLRA1) Rabbit Polyclonal Antibody
TA330417

USD 375.00

5 Days

Rabbit Polyclonal Anti-GLRA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLRA1 antibody: synthetic peptide directed towards the middle region of human GLRA1. Synthetic peptide located within the following region: TMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKHYNTGKFTCIE
alpha 1 Glycine Receptor (GLRA1) Rabbit Polyclonal Antibody
TA321076

USD 345.00

In Stock

Anti-GLRA1/GLRA2/GLRA3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 219-233 amino acids of Human glycine receptor, alpha 1
alpha 1 Glycine Receptor (GLRA1) Rabbit Polyclonal Antibody
TA321077

USD 345.00

In Stock

Anti-GLRA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 141-155 amino acids of human glycine receptor, alpha 1
alpha 1 Glycine Receptor (GLRA1) Rabbit Polyclonal Antibody
TA321078

USD 345.00

In Stock

Anti-GLRA1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 141-155 amino acids of human glycine receptor, alpha 1
alpha 1 Glycine Receptor (GLRA1) Rabbit Polyclonal Antibody
TA350686

USD 345.00

In Stock

Rabbit Polyclonal Anti-GAMT Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GLRA1
alpha 1 Glycine Receptor (GLRA1) ICC Control Block
TB410390

USD 1,070.00

4 Weeks

Transient overexpression of GLRA1 (NM_000171) in HEK293T cells paraffin embedded controls for ICC/IHC staining

alpha 1 Glycine Receptor (GLRA1) ICC Control Block
TB428907

USD 1,070.00

4 Weeks

Transient overexpression of GLRA1 (NM_001146040) in HEK293T cells paraffin embedded controls for ICC/IHC staining

alpha 1 Glycine Receptor (GLRA1) ICC Control Block
TB437745

USD 1,070.00

4 Weeks

Transient overexpression of GLRA1 (NM_001292000) in HEK293T cells paraffin embedded controls for ICC/IHC staining

alpha 1 Glycine Receptor (GLRA1) Cytosection
TS410390

USD 225.00

4 Weeks

Transient overexpression of GLRA1 (NM_000171) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

alpha 1 Glycine Receptor (GLRA1) Cytosection
TS410390P5

USD 889.00

4 Weeks

Transient overexpression of GLRA1 (NM_000171) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

alpha 1 Glycine Receptor (GLRA1) Cytosection
TS428907

USD 225.00

4 Weeks

Transient overexpression of GLRA1 (NM_001146040) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

alpha 1 Glycine Receptor (GLRA1) Cytosection
TS428907P5

USD 889.00

4 Weeks

Transient overexpression of GLRA1 (NM_001146040) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

alpha 1 Glycine Receptor (GLRA1) ICC Control Sections
TS437745P5

USD 889.00

4 Weeks

Transient overexpression of GLRA1 (NM_001292000) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack