Products

cDNA Clones (8)
Proteins (3)
Antibodies (1)
Jump to Filters
View as table Download
GABRR2 (NM_002043) Human Tagged ORF Clone
RC218663

USD 450.00

In Stock

GABRR2 (Myc-DDK-tagged)-Human gamma-aminobutyric acid (GABA) receptor, rho 2 (GABRR2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GABRR2 (NM_002043) Human Tagged ORF Clone
RG218663

USD 500.00

In Stock

GABRR2 (GFP-tagged) - Human gamma-aminobutyric acid (GABA) receptor, rho 2 (GABRR2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GABRR2 (NM_002043) Human Tagged ORF Clone
RC218663L3

USD 650.00

3 Weeks

Lenti-ORF clone of GABRR2 (Myc-DDK-tagged)-Human gamma-aminobutyric acid (GABA) receptor, rho 2 (GABRR2)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GABRR2 (NM_002043) Human Tagged ORF Clone Lentiviral Particle
RC218663L3V

USD 850.00

6 Weeks

Lenti ORF particles, GABRR2 (Myc-DDK-tagged)-Human gamma-aminobutyric acid (GABA) receptor, rho 2 (GABRR2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GABRR2 (NM_002043) Human Tagged ORF Clone
RC218663L4

USD 650.00

3 Weeks

Lenti-ORF clone of GABRR2 (mGFP-tagged)-Human gamma-aminobutyric acid (GABA) receptor, rho 2 (GABRR2)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GABRR2 (NM_002043) Human Tagged ORF Clone Lentiviral Particle
RC218663L4V

USD 850.00

6 Weeks

Lenti ORF particles, GABRR2 (mGFP-tagged)-Human gamma-aminobutyric acid (GABA) receptor, rho 2 (GABRR2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GABRR2 (NM_002043) Human Untagged Clone
SC123929

USD 830.00

In Stock

GABRR2 (untagged)-Human gamma-aminobutyric acid (GABA) receptor, rho 2 (GABRR2)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
GABRR2 Rabbit Polyclonal Antibody
TA338522

USD 375.00

5 Days

Rabbit Polyclonal Anti-GABRR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRR2 antibody: synthetic peptide directed towards the middle region of human GABRR2. Synthetic peptide located within the following region: SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY
GABRR2 (NM_002043) Human Untagged Clone
SC317820

USD 830.00

3 Weeks

GABRR2 (untagged)-Human gamma-aminobutyric acid (GABA) receptor, rho 2 (GABRR2)

Vector pCMV6 series
Tag Tag Free
GABRR2 ICC Control Block
TB418663

USD 1,100.00

4 Weeks

Transient overexpression of GABRR2 (NM_002043) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GABRR2 Cytosection
TS418663

USD 225.00

4 Weeks

Transient overexpression of GABRR2 (NM_002043) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GABRR2 Cytosection
TS418663P5

USD 889.00

4 Weeks

Transient overexpression of GABRR2 (NM_002043) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack