Products

View as table Download

ASIC5 (Myc-DDK-tagged)-Human amiloride-sensitive cation channel 5, intestinal (ACCN5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF clone of Human amiloride-sensitive cation channel 5, intestinal (ACCN5), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ASIC5 (Myc-DDK tagged) - Human amiloride-sensitive cation channel 5, intestinal (ACCN5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human amiloride-sensitive cation channel 5, intestinal (ACCN5), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ASIC5 (GFP-tagged) - Human amiloride-sensitive cation channel 5, intestinal (ACCN5)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ASIC5 (untagged)-Human amiloride-sensitive cation channel 5, intestinal (ACCN5)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal Anti-ACCN5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACCN5 antibody: synthetic peptide directed towards the middle region of human ACCN5. Synthetic peptide located within the following region: FTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVD

ASIC5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of amiloride-sensitive cation channel 5, intestinal (ACCN5)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

ACCN5 MS Standard C13 and N15-labeled recombinant protein (NP_059115)

Tag C-Myc/DDK
Expression Host HEK293

Transient overexpression of ASIC5 (NM_017419) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of ASIC5 (NM_017419) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of ASIC5 (NM_017419) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack