ASIC5 (Myc-DDK-tagged)-Human amiloride-sensitive cation channel 5, intestinal (ACCN5)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ASIC5 (Myc-DDK-tagged)-Human amiloride-sensitive cation channel 5, intestinal (ACCN5)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human amiloride-sensitive cation channel 5, intestinal (ACCN5), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ASIC5 (Myc-DDK tagged) - Human amiloride-sensitive cation channel 5, intestinal (ACCN5), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human amiloride-sensitive cation channel 5, intestinal (ACCN5), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ASIC5 (mGFP-tagged) - Human amiloride-sensitive cation channel 5, intestinal (ACCN5), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ASIC5 (GFP-tagged) - Human amiloride-sensitive cation channel 5, intestinal (ACCN5)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ASIC5 (untagged)-Human amiloride-sensitive cation channel 5, intestinal (ACCN5)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal Anti-ACCN5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACCN5 antibody: synthetic peptide directed towards the middle region of human ACCN5. Synthetic peptide located within the following region: FTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVD |
ASIC5 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of amiloride-sensitive cation channel 5, intestinal (ACCN5)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
ACCN5 MS Standard C13 and N15-labeled recombinant protein (NP_059115)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of ASIC5 (NM_017419) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ASIC5 (NM_017419) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ASIC5 (NM_017419) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack