CACNB3 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
CACNB3 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human calcium channel, voltage-dependent, beta 3 subunit (CACNB3)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CACNB3 (untagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF particles, CACNB3 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CACNB3 (mGFP-tagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CACNB3 (GFP-tagged) - Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CACNB3 (GFP-tagged) - Homo sapiens calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CACNB3 (GFP-tagged) - Homo sapiens calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CACNB3 (GFP-tagged) - Homo sapiens calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of CACNB3 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CACNB3 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CACNB3 (mGFP-tagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CACNB3 (Myc-DDK tagged) - Homo sapiens calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CACNB3 (Myc-DDK tagged) - Homo sapiens calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CACNB3 (Myc-DDK tagged) - Homo sapiens calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of CACNB3 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti-ORF clone of CACNB3 (mGFP-tagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CACNB3 (mGFP-tagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CACNB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CACNB3 antibody is: synthetic peptide directed towards the C-terminal region of Human CACNB3. Synthetic peptide located within the following region: QDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDS |
Rabbit Polyclonal Anti-CACNB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACNB3 antibody: synthetic peptide directed towards the C terminal of human CACNB3. Synthetic peptide located within the following region: EHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPH |
Rabbit Polyclonal Anti-CACNB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACNB3 antibody: synthetic peptide directed towards the n terminal of human CACNB3. Synthetic peptide located within the following region: MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQ |
CACNB3 MS Standard C13 and N15-labeled recombinant protein (NP_000716)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CACNB3 (untagged) - Homo sapiens calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
CACNB3 (untagged) - Homo sapiens calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
CACNB3 (untagged) - Homo sapiens calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of CACNB3 (NM_000725) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CACNB3 (NM_001206915) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CACNB3 (NM_001206917) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CACNB3 (NM_001206916) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CACNB3 (NM_000725) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CACNB3 (NM_000725) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CACNB3 (NM_001206915) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CACNB3 (NM_001206917) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CACNB3 (NM_001206916) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack