Products

View as table Download

CACNB3 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

CACNB3 (untagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SC122090 is the updated version of SC119727.

Lenti ORF particles, CACNB3 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, CACNB3 (mGFP-tagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

CACNB3 (GFP-tagged) - Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CACNB3 (GFP-tagged) - Homo sapiens calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CACNB3 (GFP-tagged) - Homo sapiens calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CACNB3 (GFP-tagged) - Homo sapiens calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of CACNB3 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CACNB3 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CACNB3 (mGFP-tagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CACNB3 (Myc-DDK tagged) - Homo sapiens calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

CACNB3 (Myc-DDK tagged) - Homo sapiens calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

CACNB3 (Myc-DDK tagged) - Homo sapiens calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of CACNB3 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti-ORF clone of CACNB3 (mGFP-tagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of CACNB3 (mGFP-tagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-CACNB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CACNB3 antibody is: synthetic peptide directed towards the C-terminal region of Human CACNB3. Synthetic peptide located within the following region: QDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDS

Rabbit Polyclonal Anti-CACNB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB3 antibody: synthetic peptide directed towards the C terminal of human CACNB3. Synthetic peptide located within the following region: EHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPH

Rabbit Polyclonal Anti-CACNB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB3 antibody: synthetic peptide directed towards the n terminal of human CACNB3. Synthetic peptide located within the following region: MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQ

CACNB3 MS Standard C13 and N15-labeled recombinant protein (NP_000716)

Tag C-Myc/DDK
Expression Host HEK293

CACNB3 (untagged) - Homo sapiens calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 2

Vector pCMV6 series
Tag Tag Free

CACNB3 (untagged) - Homo sapiens calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 3

Vector pCMV6 series
Tag Tag Free

CACNB3 (untagged) - Homo sapiens calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 4

Vector pCMV6 series
Tag Tag Free

Transient overexpression of CACNB3 (NM_000725) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CACNB3 (NM_001206915) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CACNB3 (NM_001206917) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CACNB3 (NM_001206916) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of CACNB3 (NM_000725) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of CACNB3 (NM_000725) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of CACNB3 (NM_001206915) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of CACNB3 (NM_001206917) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of CACNB3 (NM_001206916) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack