Products

cDNA Clones (21)
Proteins (16)
Antibodies (5)
Jump to Filters
View as table Download
KCTD15 (NM_024076) Human Tagged ORF Clone
RC200838

USD 98.00

USD 390.00

In Stock

KCTD15 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
KCTD15 (NM_001129994) Human Tagged ORF Clone
RC225391

USD 420.00

In Stock

KCTD15 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
KCTD15 (NM_001129995) Human Tagged ORF Clone
RC225392

USD 420.00

In Stock

KCTD15 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
KCTD15 (NM_024076) Human Tagged ORF Clone
RG200838

USD 460.00

In Stock

KCTD15 (GFP-tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCTD15 (NM_024076) Human Tagged ORF Clone
RC200838L3

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD15 (NM_024076) Human Tagged ORF Clone Lentiviral Particle
RC200838L3V

USD 820.00

6 Weeks

Lenti ORF particles, KCTD15 (Myc-DDK tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD15 (NM_024076) Human Tagged ORF Clone
RC200838L4

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD15 (NM_024076) Human Tagged ORF Clone Lentiviral Particle
RC200838L4V

USD 820.00

6 Weeks

Lenti ORF particles, KCTD15 (mGFP-tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD15 (NM_001129994) Human Tagged ORF Clone
RC225391L3

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD15 (NM_001129994) Human Tagged ORF Clone Lentiviral Particle
RC225391L3V

USD 820.00

6 Weeks

Lenti ORF particles, KCTD15 (Myc-DDK tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD15 (NM_001129994) Human Tagged ORF Clone
RC225391L4

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD15 (NM_001129994) Human Tagged ORF Clone Lentiviral Particle
RC225391L4V

USD 820.00

6 Weeks

Lenti ORF particles, KCTD15 (mGFP-tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD15 (NM_001129995) Human Tagged ORF Clone
RC225392L3

USD 620.00

3 Weeks

Lenti-ORF clone of KCTD15 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD15 (NM_001129995) Human Tagged ORF Clone Lentiviral Particle
RC225392L3V

USD 820.00

6 Weeks

Lenti ORF particles, KCTD15 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD15 (NM_001129995) Human Tagged ORF Clone
RC225392L4

USD 620.00

3 Weeks

Lenti-ORF clone of KCTD15 (mGFP-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD15 (NM_001129995) Human Tagged ORF Clone Lentiviral Particle
RC225392L4V

USD 820.00

6 Weeks

Lenti ORF particles, KCTD15 (mGFP-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD15 (NM_001129994) Human Tagged ORF Clone
RG225391

USD 460.00

3 Weeks

KCTD15 (GFP-tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCTD15 (NM_001129995) Human Tagged ORF Clone
RG225392

USD 460.00

3 Weeks

KCTD15 (GFP-tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCTD15 Mouse Monoclonal Antibody [Clone ID: AT4C3]
AM09364PU-N

USD 340.00

2 Weeks

KCTD15 mouse monoclonal antibody, clone AT4C3, Purified

Applications ELISA, FC, IF, WB
Reactivities Human
KCTD15 Mouse Monoclonal Antibody [Clone ID: AT4C3]
AM09364PU-S

USD 230.00

2 Weeks

KCTD15 mouse monoclonal antibody, clone AT4C3, Purified

Applications ELISA, FC, IF, WB
Reactivities Human
KCTD15 (C-term) Rabbit Polyclonal Antibody
AP23868PU-N

USD 440.00

2 Weeks

KCTD15 (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated
KCTD15 Rabbit Polyclonal Antibody
TA306747

USD 430.00

5 Days

Rabbit Polyclonal KCTD15 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KCTD15 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human KCTD15.
KCTD15 (NM_024076) Human Untagged Clone
SC319396

USD 310.00

In Stock

KCTD15 (untagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
KCTD15 Rabbit Polyclonal Antibody
TA338710

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCTD15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCTD15 antibody: synthetic peptide directed towards the N terminal of human KCTD15. Synthetic peptide located within the following region: PVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRL
KCTD15 (1-234, His-tag) Human Protein
AR50717PU-N

USD 845.00

2 Weeks

KCTD15 (1-234, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
KCTD15 (1-234, His-tag) Human Protein
AR50717PU-S

USD 330.00

2 Weeks

KCTD15 (1-234, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
KCTD15 (NM_024076) Human Over-expression Lysate
LC411332

USD 121.00

2 Weeks

KCTD15 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCTD15 (NM_024076) Human Over-expression Lysate
LY411332

USD 396.00

5 Days

Transient overexpression lysate of potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCTD15 (NM_024076) Human Mass Spec Standard
PH300838

USD 2,055.00

3 Weeks

KCTD15 MS Standard C13 and N15-labeled recombinant protein (NP_076981)

Tag C-Myc/DDK
Expression Host HEK293
KCTD15 (NM_001129994) Human Mass Spec Standard
PH325391

USD 2,055.00

3 Weeks

KCTD15 MS Standard C13 and N15-labeled recombinant protein (NP_001123466)

Tag C-Myc/DDK
Expression Host HEK293
KCTD15 (NM_001129994) Human Untagged Clone
SC322947

USD 660.00

3 Weeks

KCTD15 (untagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
KCTD15 (NM_001129995) Human Untagged Clone
SC322949

USD 660.00

4 Weeks

KCTD15 (untagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 3

Vector pCMV6 series
Tag Tag Free
KCTD15 (NM_024076) ICC Control Block
TB400838

USD 1,040.00

4 Weeks

Transient overexpression of KCTD15 (NM_024076) in HEK293T cells paraffin embedded controls for ICC/IHC staining

KCTD15 (NM_001129994) ICC Control Block
TB425391

USD 1,070.00

4 Weeks

Transient overexpression of KCTD15 (NM_001129994) in HEK293T cells paraffin embedded controls for ICC/IHC staining

KCTD15 (NM_001129995) ICC Control Block
TB425392

USD 1,070.00

4 Weeks

Transient overexpression of KCTD15 (NM_001129995) in HEK293T cells paraffin embedded controls for ICC/IHC staining

KCTD15 Cytosection
TS400838

USD 225.00

4 Weeks

Transient overexpression of KCTD15 (NM_024076) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

KCTD15 Cytosection
TS400838P5

USD 889.00

4 Weeks

Transient overexpression of KCTD15 (NM_024076) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

KCTD15 Cytosection
TS425391

USD 225.00

4 Weeks

Transient overexpression of KCTD15 (NM_001129994) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

KCTD15 Cytosection
TS425391P5

USD 889.00

4 Weeks

Transient overexpression of KCTD15 (NM_001129994) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

KCTD15 Cytosection
TS425392

USD 225.00

4 Weeks

Transient overexpression of KCTD15 (NM_001129995) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

KCTD15 Cytosection
TS425392P5

USD 889.00

4 Weeks

Transient overexpression of KCTD15 (NM_001129995) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack