KCTD15 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
KCTD15 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Kctd15 (Myc-DDK-tagged) - Mouse potassium channel tetramerisation domain containing 15 (Kctd15)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
KCTD15 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
KCTD15 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
KCTD15 (GFP-tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
KCTD15 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Kctd15 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Kctd15 (GFP-tagged) - Mouse potassium channel tetramerisation domain containing 15 (Kctd15)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Kctd15 (Myc-DDK-tagged) - Mouse potassium channel tetramerisation domain containing 15 (Kctd15)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Kctd15 (Myc-DDK-tagged) - Mouse potassium channel tetramerisation domain containing 15 (Kctd15), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Kctd15 (mGFP-tagged) - Mouse potassium channel tetramerisation domain containing 15 (Kctd15)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Kctd15 (GFP-tagged) - Mouse potassium channel tetramerisation domain containing 15 (Kctd15), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, KCTD15 (Myc-DDK tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, KCTD15 (mGFP-tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, KCTD15 (Myc-DDK tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, KCTD15 (mGFP-tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of KCTD15 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, KCTD15 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of KCTD15 (mGFP-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, KCTD15 (mGFP-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
KCTD15 (GFP-tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
KCTD15 (GFP-tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Kctd15 (Myc-DDK-tagged ORF) - Rat potassium channel tetramerisation domain containing 15 (Kctd15), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Kctd15 (Myc-DDK-tagged ORF) - Rat potassium channel tetramerisation domain containing 15 (Kctd15), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Kctd15 (Myc-DDK-tagged ORF) - Rat potassium channel tetramerisation domain containing 15 (Kctd15), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Kctd15 (mGFP-tagged ORF) - Rat potassium channel tetramerisation domain containing 15 (Kctd15), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Kctd15 (GFP-tagged ORF) - Rat potassium channel tetramerisation domain containing 15 (Kctd15), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
KCTD15 mouse monoclonal antibody, clone AT4C3, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
KCTD15 mouse monoclonal antibody, clone AT4C3, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
KCTD15 (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide - KLH conjugated |
Rabbit Polyclonal KCTD15 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | KCTD15 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human KCTD15. |
KCTD15 (untagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-KCTD15 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCTD15 antibody: synthetic peptide directed towards the N terminal of human KCTD15. Synthetic peptide located within the following region: PVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRL |
KCTD15 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
KCTD15 (1-234, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
KCTD15 (1-234, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
KCTD15 CRISPRa kit - CRISPR gene activation of human potassium channel tetramerization domain containing 15
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Kctd15 CRISPRa kit - CRISPR gene activation of mouse potassium channel tetramerisation domain containing 15
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene KCTD15
Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene KCTD15
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene KCTD15
KCTD15 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Kctd15 (untagged) - Mouse potassium channel tetramerisation domain containing 15 (Kctd15), (10ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Kctd15