Products

View as table Download

USD 98.00

USD 390.00

In Stock

KCTD15 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

USD 68.00

USD 149.00

In Stock

Kctd15 (Myc-DDK-tagged) - Mouse potassium channel tetramerisation domain containing 15 (Kctd15)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

KCTD15 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

KCTD15 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

KCTD15 (GFP-tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

KCTD15 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN400838 is the updated version of KN200838.

Kctd15 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN508708 is the updated version of KN308708.

Kctd15 (GFP-tagged) - Mouse potassium channel tetramerisation domain containing 15 (Kctd15)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Kctd15 (Myc-DDK-tagged) - Mouse potassium channel tetramerisation domain containing 15 (Kctd15)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Kctd15 (Myc-DDK-tagged) - Mouse potassium channel tetramerisation domain containing 15 (Kctd15), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Kctd15 (mGFP-tagged) - Mouse potassium channel tetramerisation domain containing 15 (Kctd15)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Kctd15 (GFP-tagged) - Mouse potassium channel tetramerisation domain containing 15 (Kctd15), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, KCTD15 (Myc-DDK tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, KCTD15 (mGFP-tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, KCTD15 (Myc-DDK tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, KCTD15 (mGFP-tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of KCTD15 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, KCTD15 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of KCTD15 (mGFP-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, KCTD15 (mGFP-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

KCTD15 (GFP-tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

KCTD15 (GFP-tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Kctd15 (Myc-DDK-tagged ORF) - Rat potassium channel tetramerisation domain containing 15 (Kctd15), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Kctd15 (Myc-DDK-tagged ORF) - Rat potassium channel tetramerisation domain containing 15 (Kctd15), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Kctd15 (Myc-DDK-tagged ORF) - Rat potassium channel tetramerisation domain containing 15 (Kctd15), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Kctd15 (mGFP-tagged ORF) - Rat potassium channel tetramerisation domain containing 15 (Kctd15), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Kctd15 (GFP-tagged ORF) - Rat potassium channel tetramerisation domain containing 15 (Kctd15), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

KCTD15 mouse monoclonal antibody, clone AT4C3, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

KCTD15 mouse monoclonal antibody, clone AT4C3, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

KCTD15 (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated

Rabbit Polyclonal KCTD15 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KCTD15 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human KCTD15.

KCTD15 (untagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-KCTD15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCTD15 antibody: synthetic peptide directed towards the N terminal of human KCTD15. Synthetic peptide located within the following region: PVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRL

KCTD15 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS

KCTD15 (1-234, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

KCTD15 (1-234, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

KCTD15 CRISPRa kit - CRISPR gene activation of human potassium channel tetramerization domain containing 15

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Kctd15 CRISPRa kit - CRISPR gene activation of mouse potassium channel tetramerisation domain containing 15

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene KCTD15

Application Plasmid of exact quantity for transcript copy number calculation

qPCR primer pairs and template standards against Homo sapiens gene KCTD15

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Homo sapiens gene KCTD15

KCTD15 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Kctd15 (untagged) - Mouse potassium channel tetramerisation domain containing 15 (Kctd15), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

qSTAR qPCR primer pairs against Mus musculus gene Kctd15