NR2E1 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group E, member 1 (NR2E1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
NR2E1 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group E, member 1 (NR2E1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, NR2E1 (Myc-DDK tagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, NR2E1 (mGFP-tagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
NR2E1 (GFP-tagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
NR2E1 (myc-DDK-tagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, NR2E1 (Myc-DDK tagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NR2E1 (mGFP-tagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
NR2E1 (untagged)-Human nuclear receptor subfamily 2, group E, member 1 (NR2E1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
NR2E1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of nuclear receptor subfamily 2, group E, member 1 (NR2E1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
NR2E1 (untagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-NR2E1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR2E1 antibody: synthetic peptide directed towards the N terminal of human NR2E1. Synthetic peptide located within the following region: MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY |
Rabbit Polyclonal Anti-NR2E1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NR2E1 Antibody: synthetic peptide directed towards the N terminal of human NR2E1. Synthetic peptide located within the following region: RTSTIRKQVALYFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPHGLEL |
Rabbit Polyclonal Anti-NR2E1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR2E1 antibody: synthetic peptide directed towards the middle region of human NR2E1. Synthetic peptide located within the following region: LAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLL |
Rabbit Polyclonal Anti-NR2E1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR2E1 antibody is: synthetic peptide directed towards the C-terminal region of Human NR2E1. Synthetic peptide located within the following region: TEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTR |
NR2E1 (GFP-tagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Transient overexpression of NR2E1 (NM_003269) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NR2E1 (NM_001286102) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NR2E1 (NM_003269) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NR2E1 (NM_003269) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of NR2E1 (NM_001286102) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NR2E1 (NM_001286102) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack