Products

View as table Download

NR2E1 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group E, member 1 (NR2E1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, NR2E1 (Myc-DDK tagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, NR2E1 (mGFP-tagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

NR2E1 (GFP-tagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

NR2E1 (myc-DDK-tagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, NR2E1 (Myc-DDK tagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NR2E1 (mGFP-tagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

NR2E1 (untagged)-Human nuclear receptor subfamily 2, group E, member 1 (NR2E1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

NR2E1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

NR2E1 (untagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-NR2E1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2E1 antibody: synthetic peptide directed towards the N terminal of human NR2E1. Synthetic peptide located within the following region: MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY

Rabbit Polyclonal Anti-NR2E1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NR2E1 Antibody: synthetic peptide directed towards the N terminal of human NR2E1. Synthetic peptide located within the following region: RTSTIRKQVALYFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPHGLEL

Rabbit Polyclonal Anti-NR2E1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2E1 antibody: synthetic peptide directed towards the middle region of human NR2E1. Synthetic peptide located within the following region: LAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLL

Rabbit Polyclonal Anti-NR2E1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2E1 antibody is: synthetic peptide directed towards the C-terminal region of Human NR2E1. Synthetic peptide located within the following region: TEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTR

NR2E1 (GFP-tagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

USD 1,070.00

4 Weeks

Transient overexpression of NR2E1 (NM_003269) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of NR2E1 (NM_001286102) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of NR2E1 (NM_003269) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of NR2E1 (NM_003269) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of NR2E1 (NM_001286102) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of NR2E1 (NM_001286102) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack