Germany
Japan
United Kingdom
China
NR2E1 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group E, member 1 (NR2E1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, NR2E1 (Myc-DDK tagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, NR2E1 (mGFP-tagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Nr2e1 (Myc-DDK-tagged) - Mouse nuclear receptor subfamily 2, group E, member 1 (Nr2e1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NR2E1 (GFP-tagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NR2E1 (myc-DDK-tagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NR2E1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN407015 is the updated version of KN207015.
Nr2e1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN511204 is the updated version of KN311204.
Nr2e1 (GFP-tagged) - Mouse nuclear receptor subfamily 2, group E, member 1 (Nr2e1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, NR2E1 (Myc-DDK tagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NR2E1 (mGFP-tagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Nr2e1 (Myc-DDK-tagged ORF) - Rat nuclear receptor subfamily 2, group E, member 1 (Nr2e1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Nr2e1 (Myc-DDK-tagged ORF) - Rat nuclear receptor subfamily 2, group E, member 1 (Nr2e1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Nr2e1 (Myc-DDK-tagged ORF) - Rat nuclear receptor subfamily 2, group E, member 1 (Nr2e1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Nr2e1 (mGFP-tagged ORF) - Rat nuclear receptor subfamily 2, group E, member 1 (Nr2e1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Nr2e1 (GFP-tagged ORF) - Rat nuclear receptor subfamily 2, group E, member 1 (Nr2e1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
NR2E1 (untagged)-Human nuclear receptor subfamily 2, group E, member 1 (NR2E1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Nr2e1 (Myc-DDK-tagged) - Mouse nuclear receptor subfamily 2, group E, member 1 (Nr2e1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Nr2e1 (Myc-DDK-tagged) - Mouse nuclear receptor subfamily 2, group E, member 1 (Nr2e1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Nr2e1 (mGFP-tagged) - Mouse nuclear receptor subfamily 2, group E, member 1 (Nr2e1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Nr2e1 (untagged) - Mouse nuclear receptor subfamily 2, group E, member 1 (Nr2e1), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, Nr2e1 (GFP-tagged) - Mouse nuclear receptor subfamily 2, group E, member 1 (Nr2e1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Nr2e1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
qSTAR qPCR primer pairs against Homo sapiens gene NR2E1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
NR2E1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of nuclear receptor subfamily 2, group E, member 1 (NR2E1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NR2E1 (untagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-NR2E1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2E1 antibody: synthetic peptide directed towards the N terminal of human NR2E1. Synthetic peptide located within the following region: MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY |
NR2E1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
qSTAR qPCR primer pairs against Mus musculus gene Nr2e1
Rabbit Polyclonal Anti-NR2E1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NR2E1 Antibody: synthetic peptide directed towards the N terminal of human NR2E1. Synthetic peptide located within the following region: RTSTIRKQVALYFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPHGLEL |
Rabbit Polyclonal Anti-NR2E1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2E1 antibody: synthetic peptide directed towards the middle region of human NR2E1. Synthetic peptide located within the following region: LAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLL |
Rabbit Polyclonal Anti-NR2E1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2E1 antibody is: synthetic peptide directed towards the C-terminal region of Human NR2E1. Synthetic peptide located within the following region: TEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTR |
NR2E1 CRISPRa kit - CRISPR gene activation of human nuclear receptor subfamily 2 group E member 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Nr2e1 CRISPRa kit - CRISPR gene activation of mouse nuclear receptor subfamily 2, group E, member 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene NR2E1
| Application | Plasmid of exact quantity for transcript copy number calculation |
NR2E1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
NR2E1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
NR2E1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | RFP-BSD |
qPCR primer pairs and template standards against Mus musculus gene Nr2e1
| Application | Plasmid of exact quantity for transcript copy number calculation |
NR2E1 (GFP-tagged) - Human nuclear receptor subfamily 2, group E, member 1 (NR2E1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Nr2e1 (untagged ORF) - Rat nuclear receptor subfamily 2, group E, member 1 (Nr2e1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of nuclear receptor subfamily 2 group E member 1 (NR2E1) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
NR2E1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Nr2e1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
NR2E1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NR2E1 |
Active filters
Target Symbol
- NR2E1