RXRA (Myc-DDK-tagged)-Human retinoid X receptor, alpha (RXRA)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RXRA (Myc-DDK-tagged)-Human retinoid X receptor, alpha (RXRA)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RXRA (untagged)-Human retinoid X receptor, alpha (RXRA)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Recombinant protein of human retinoid X receptor, alpha (RXRA)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
RXRA (GFP-tagged) - Human retinoid X receptor, alpha (RXRA)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 820.00
2 Weeks
Lenti ORF particles, RXRA (Myc-DDK tagged) - Human retinoid X receptor, alpha (RXRA), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, RXRA (mGFP-tagged) - Human retinoid X receptor, alpha (RXRA), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
5 Weeks
Lenti ORF particles, RXRA (Myc-DDK tagged) - Human retinoid X receptor, alpha (RXRA), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, RXRA (mGFP-tagged) - Human retinoid X receptor, alpha (RXRA), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
RXRA (myc-DDK-tagged) - Human retinoid X receptor, alpha (RXRA), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RXRA (myc-DDK-tagged) - Human retinoid X receptor, alpha (RXRA), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human retinoid X receptor, alpha (RXRA), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-RXRA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI |
USD 396.00
5 Days
Transient overexpression lysate of retinoid X receptor, alpha (RXRA)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human retinoid X receptor, alpha (RXRA), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Goat Polyclonal Antibody against RXRA
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CQVNSSLTSPTGRGSM, from the internal region of the protein sequence according to NP_002948.1. |
USD 121.00
In Stock
RXRA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal Anti-RXRA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the C terminal of human RXRA. Synthetic peptide located within the following region: MDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQ |
Rabbit Polyclonal Anti-RXRA Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RXRA antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: GPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGF |
Rabbit Polyclonal Anti-RXRA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RXRA antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI |
Rabbit Polyclonal Anti-RXRA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RXRA antibody: synthetic peptide directed towards the C terminal of human RXRA. Synthetic peptide located within the following region: MDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQ |
RXRA MS Standard C13 and N15-labeled recombinant protein (NP_002948)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
RXRA (GFP-tagged) - Human retinoid X receptor, alpha (RXRA), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
RXRA (GFP-tagged) - Human retinoid X receptor, alpha (RXRA), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
RXR-alpha / RXRA (111-228) human protein, 0.1 mg
Expression Host | E. coli |
RXR-alpha / RXRA (111-228) human protein, 0.5 mg
Expression Host | E. coli |
RXRA (untagged) - Human retinoid X receptor, alpha (RXRA), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
RXRA (untagged) - Human retinoid X receptor, alpha (RXRA), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of RXRA (NM_002957) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RXRA (NM_001291921) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RXRA (NM_001291920) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RXRA (NM_002957) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RXRA (NM_002957) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RXRA (NM_001291921) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RXRA (NM_001291920) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack