Germany
Japan
United Kingdom
China
CYP1A1 (Myc-DDK-tagged)-Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, CYP1A1 (Myc-DDK tagged) - Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CYP1A1 (mGFP-tagged) - Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CYP1A1 (GFP-tagged) - Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CYP1A1 (untagged)-Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF particles, CYP1A1 (mGFP-tagged) - Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, CYP1A1 (Myc-DDK tagged) - Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
CYP1A1 (untagged)-Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CYP1A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV |
Rabbit Polyclonal Anti-CYP1A1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV |
Transient overexpression lysate of cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit anti-CYP1A1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CYP1A1 |
Rabbit Polyclonal Anti-Cytochrome P450 1A1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cytochrome P450 1A1/2 Antibody: A synthesized peptide derived from human Cytochrome P450 1A1/2 |
CYP1A1 (+CYP1A2) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 71-120 of Human CYP1A1. |
Lenti ORF clone of Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal Cytochrome P450 1A1/2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 1A1/2. |
CYP1A1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Goat Anti-cytochrome P450 1A1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CQEKQLDENANVQ, from the internal region of the protein sequence according to NP_000490.1 |
Rabbit polyclonal anti-Cytochrome P450 (CYP1A1,CYP1A2) antibody
| Reactivities | Rat |
| Immunogen | Cytochrome P450 (CYP1A1,CYP1A2) |
Rabbit polyclonal anti-Cytochrome P450 (CYP1A1) antibody
| Reactivities | Rat |
| Immunogen | Cytochrome P450 (CYP1A1) |
CYP1A1 MS Standard C13 and N15-labeled recombinant protein (NP_000490)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Rabbit Polyclonal Anti-CYP1A1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CYP1A1 |
Transient overexpression of CYP1A1 (NM_000499) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), full-length, with N-terminal Myc-ddk tag, expressed in E.coli, 50ug
| Tag | Myc-DDK |
| Expression Host | E. coli |
Transient overexpression of CYP1A1 (NM_000499) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP1A1 (NM_000499) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CYP1A1
Families
- P450