CYP1A1 (Myc-DDK-tagged)-Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CYP1A1 (Myc-DDK-tagged)-Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, CYP1A1 (Myc-DDK tagged) - Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CYP1A1 (mGFP-tagged) - Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CYP1A1 (GFP-tagged) - Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CYP1A1 (untagged)-Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF particles, CYP1A1 (mGFP-tagged) - Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CYP1A1 (Myc-DDK tagged) - Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
CYP1A1 (untagged)-Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CYP1A1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV |
Rabbit Polyclonal Anti-CYP1A1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV |
Transient overexpression lysate of cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit anti-CYP1A1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYP1A1 |
Rabbit Polyclonal Anti-Cytochrome P450 1A1/2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cytochrome P450 1A1/2 Antibody: A synthesized peptide derived from human Cytochrome P450 1A1/2 |
CYP1A1 (+CYP1A2) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 71-120 of Human CYP1A1. |
Lenti ORF clone of Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal Cytochrome P450 1A1/2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 1A1/2. |
CYP1A1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Mouse monoclonal Anti-Cytochrome P450 1A1 and 1A2 Clone MC1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Anti-cytochrome P450 1A1 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CQEKQLDENANVQ, from the internal region of the protein sequence according to NP_000490.1 |
Rabbit polyclonal anti-Cytochrome P450 (CYP1A1,CYP1A2) antibody
Reactivities | Rat |
Immunogen | Cytochrome P450 (CYP1A1,CYP1A2) |
Rabbit polyclonal anti-Cytochrome P450 (CYP1A1) antibody
Reactivities | Rat |
Immunogen | Cytochrome P450 (CYP1A1) |
CYP1A1 MS Standard C13 and N15-labeled recombinant protein (NP_000490)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Anti-CYP1A1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human cytochrome P450, family 1, subfamily A, polypeptide 1 |
Rabbit Polyclonal Anti-CYP1A1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CYP1A1 |
Transient overexpression of CYP1A1 (NM_000499) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), full-length, with N-terminal Myc-ddk tag, expressed in E.coli, 50ug
Tag | Myc-DDK |
Expression Host | E. coli |
Transient overexpression of CYP1A1 (NM_000499) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP1A1 (NM_000499) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack