Germany
Japan
United Kingdom
China
CYP2R1 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, CYP2R1 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CYP2R1 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
CYP2R1 (GFP-tagged) - Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYP2R1 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYP2R1 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CYP2R1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CYP2R1 (untagged)-Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CYP2R1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2R1 antibody: synthetic peptide directed towards the middle region of human CYP2R1. Synthetic peptide located within the following region: FKQLITNAVSNITNLIIFGERFTYEDTDFQHMIELFSENVELAASASVFL |
Rabbit Polyclonal Anti-CYP2R1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CYP2R1 antibody is: synthetic peptide directed towards the C-terminal region of Human CYP2R1. Synthetic peptide located within the following region: ALVPFSLGRRHCLGEHLARMEMFLFFTALLQRFHLHFPHELVPDLKPRLG |
CYP2R1 MS Standard C13 and N15-labeled recombinant protein (NP_078790)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
CYP2R1 (untagged)-Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of CYP2R1 (NM_024514) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP2R1 (NM_024514) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP2R1 (NM_024514) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CYP2R1
Families
- P450