PTGIS (Myc-DDK-tagged)-Human prostaglandin I2 (prostacyclin) synthase (PTGIS)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PTGIS (Myc-DDK-tagged)-Human prostaglandin I2 (prostacyclin) synthase (PTGIS)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PTGIS (Myc-DDK tagged) - Human prostaglandin I2 (prostacyclin) synthase (PTGIS), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PTGIS (mGFP-tagged) - Human prostaglandin I2 (prostacyclin) synthase (PTGIS), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PTGIS (GFP-tagged) - Human prostaglandin I2 (prostacyclin) synthase (PTGIS)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human prostaglandin I2 (prostacyclin) synthase (PTGIS), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PTGIS (Myc-DDK tagged) - Human prostaglandin I2 (prostacyclin) synthase (PTGIS), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human prostaglandin I2 (prostacyclin) synthase (PTGIS), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PTGIS (mGFP-tagged) - Human prostaglandin I2 (prostacyclin) synthase (PTGIS), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of prostaglandin I2 (prostacyclin) synthase (PTGIS)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human prostaglandin I2 (prostacyclin) synthase (PTGIS), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-PTGIS antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PTGIS. |
Lenti ORF clone of Human prostaglandin I2 (prostacyclin) synthase (PTGIS), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PTGIS (untagged)-Human prostaglandin I2 (prostacyclin) synthase (PTGIS)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PTGIS (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 472-500 amino acids from the C-terminal region of Human CYP8A1. |
PTGIS HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal Anti-PTGIS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTGIS antibody: synthetic peptide directed towards the middle region of human PTGIS. Synthetic peptide located within the following region: EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS |
PTGIS MS Standard C13 and N15-labeled recombinant protein (NP_000952)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of PTGIS (NM_000961) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PTGIS (NM_000961) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PTGIS (NM_000961) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack