Products

cDNA Clones (12)
Proteins (3)
Antibodies (2)
Jump to Filters
View as table Download
sphingosine 1 phosphate phosphatase 1 (SGPP1) (NM_030791) Human Tagged ORF Clone Lentiviral Particle
RC209497L3V

USD 820.00

11 Weeks

Lenti ORF particles, SGPP1 (Myc-DDK-tagged)-Human sphingosine-1-phosphate phosphatase 1 (SGPP1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
sphingosine 1 phosphate phosphatase 1 (SGPP1) (NM_030791) Human Tagged ORF Clone Lentiviral Particle
RC209497L4V

USD 820.00

11 Weeks

Lenti ORF particles, SGPP1 (mGFP-tagged)-Human sphingosine-1-phosphate phosphatase 1 (SGPP1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
sphingosine 1 phosphate phosphatase 1 (SGPP1) (NM_030791) Human Tagged Lenti ORF Clone
RC209497L1

USD 768.00

In Stock

Lenti-ORF clone of SGPP1 (Myc-DDK-tagged)-Human sphingosine-1-phosphate phosphatase 1 (SGPP1)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
sphingosine 1 phosphate phosphatase 1 (SGPP1) Rabbit Polyclonal Antibody
AP05169PU-N

USD 360.00

5 Days

sphingosine 1 phosphate phosphatase 1 (SGPP1) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide derived from the sphingosine 1-phosphate phosphatase 1 protein.
sphingosine 1 phosphate phosphatase 1 (SGPP1) Rabbit Polyclonal Antibody
TA339564

USD 375.00

5 Days

Rabbit Polyclonal Anti-SGPP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGPP1 antibody: synthetic peptide directed towards the middle region of human SGPP1. Synthetic peptide located within the following region: THKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVT
sphingosine 1 phosphate phosphatase 1 (SGPP1) Cytosection
TS409497

USD 225.00

4 Weeks

Transient overexpression of SGPP1 (NM_030791) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

sphingosine 1 phosphate phosphatase 1 (SGPP1) Cytosection
TS409497P5

USD 889.00

4 Weeks

Transient overexpression of SGPP1 (NM_030791) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack