Products

cDNA Clones (18)
Proteins (8)
Antibodies (4)
Jump to Filters
View as table Download
EPM2A (NM_005670) Human Tagged ORF Clone
RC209743

USD 420.00

In Stock

EPM2A (Myc-DDK-tagged)-Human epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) (EPM2A), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
EPM2A (NM_005670) Human Tagged ORF Clone Lentiviral Particle
RC209743L1V

USD 820.00

3 Weeks

Lenti ORF particles, EPM2A (Myc-DDK tagged) - Human epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) (EPM2A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
EPM2A (NM_005670) Human Tagged ORF Clone Lentiviral Particle
RC209743L2V

USD 820.00

6 Weeks

Lenti ORF particles, EPM2A (mGFP-tagged) - Human epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) (EPM2A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
EPM2A (NM_001018041) Human Tagged ORF Clone
RC221554

USD 420.00

In Stock

EPM2A (Myc-DDK-tagged)-Human epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) (EPM2A), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
EPM2A (NM_005670) Human Tagged ORF Clone
RC209743L3

USD 620.00

3 Weeks

Lenti ORF clone of Human epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) (EPM2A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EPM2A (NM_005670) Human Tagged ORF Clone Lentiviral Particle
RC209743L3V

USD 820.00

7 Weeks

Lenti ORF particles, EPM2A (Myc-DDK tagged) - Human epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) (EPM2A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EPM2A (NM_005670) Human Tagged ORF Clone
RC209743L4

USD 620.00

3 Weeks

Lenti ORF clone of Human epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) (EPM2A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EPM2A (NM_005670) Human Tagged ORF Clone Lentiviral Particle
RC209743L4V

USD 820.00

7 Weeks

Lenti ORF particles, EPM2A (mGFP-tagged) - Human epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) (EPM2A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EPM2A (NM_001018041) Human Tagged ORF Clone
RC221554L3

USD 620.00

3 Weeks

Lenti-ORF clone of EPM2A (Myc-DDK-tagged)-Human epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) (EPM2A), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EPM2A (NM_001018041) Human Tagged ORF Clone Lentiviral Particle
RC221554L3V

USD 820.00

6 Weeks

Lenti ORF particles, EPM2A (Myc-DDK-tagged)-Human epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) (EPM2A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EPM2A (NM_001018041) Human Tagged ORF Clone
RC221554L4

USD 620.00

3 Weeks

Lenti-ORF clone of EPM2A (mGFP-tagged)-Human epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) (EPM2A), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EPM2A (NM_001018041) Human Tagged ORF Clone Lentiviral Particle
RC221554L4V

USD 820.00

6 Weeks

Lenti ORF particles, EPM2A (mGFP-tagged)-Human epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) (EPM2A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EPM2A (NM_005670) Human Tagged ORF Clone
RG209743

USD 460.00

3 Weeks

EPM2A (GFP-tagged) - Human epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) (EPM2A), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EPM2A (NM_001018041) Human Tagged ORF Clone
RG221554

USD 460.00

3 Weeks

EPM2A (GFP-tagged) - Human epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) (EPM2A), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EPM2A (NM_005670) Human Tagged Lenti ORF Clone
RC209743L1

USD 768.00

In Stock

Lenti ORF clone of Human epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) (EPM2A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
EPM2A (NM_005670) Human Untagged Clone
SC116585

USD 310.00

In Stock

EPM2A (untagged)-Human epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) (EPM2A), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
EPM2A (NM_005670) Human Tagged ORF Clone
RC209743L2

USD 620.00

3 Weeks

Lenti ORF clone of Human epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) (EPM2A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
EPM2A (NM_005670) Human Over-expression Lysate
LC417140

USD 121.00

In Stock

EPM2A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
EPM2A (NM_005670) Human Over-expression Lysate
LY417140

USD 396.00

In Stock

Transient overexpression lysate of epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) (EPM2A), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
EPM2A Rabbit Polyclonal Antibody
TA319742

USD 430.00

5 Days

Rabbit Polyclonal EPM2A Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen EPM2A antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human EPM2A.
EPM2A Goat Polyclonal Antibody
TA305859

USD 375.00

5 Days

Goat Anti-Laforin (isoform a) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EATGHTNEMKHTTD, from the internal region of the protein sequence according to NP_005661.1.
EPM2A Rabbit Polyclonal Antibody
TA343303

USD 375.00

5 Days

Rabbit Polyclonal Anti-EPM2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPM2A antibody is: synthetic peptide directed towards the N-terminal region of Human EPM2A. Synthetic peptide located within the following region: PGRVDTFWYKFLKREPGGELSWEGNGPHHDRCCTYNENNLVDGVYCLPIG
EPM2A (NM_001018041) Human Untagged Clone
SC302137

USD 660.00

3 Weeks

EPM2A (untagged)-Human epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) (EPM2A), transcript variant 2

Vector pCMV6 series
Tag Tag Free
EPM2A Rabbit Polyclonal Antibody
TA358411

USD 360.00

5 Days

EPM2A Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
EPM2A (NM_005670) ICC Control Block
TB409743

USD 1,070.00

4 Weeks

Transient overexpression of EPM2A (NM_005670) in HEK293T cells paraffin embedded controls for ICC/IHC staining

EPM2A (NM_001018041) ICC Control Block
TB421554

USD 1,070.00

4 Weeks

Transient overexpression of EPM2A (NM_001018041) in HEK293T cells paraffin embedded controls for ICC/IHC staining

EPM2A Cytosection
TS409743

USD 225.00

4 Weeks

Transient overexpression of EPM2A (NM_005670) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

EPM2A Cytosection
TS409743P5

USD 889.00

4 Weeks

Transient overexpression of EPM2A (NM_005670) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

EPM2A Cytosection
TS421554

USD 225.00

4 Weeks

Transient overexpression of EPM2A (NM_001018041) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

EPM2A Cytosection
TS421554P5

USD 889.00

4 Weeks

Transient overexpression of EPM2A (NM_001018041) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack