Products

Antibodies (58)
cDNA Clones (44)
Proteins (37)
Jump to Filters
View as table Download
LAP3 (NM_015907) Human Recombinant Protein
TP309052

USD 823.00

In Stock

Recombinant protein of human leucine aminopeptidase 3 (LAP3)

Tag C-Myc/DDK
Expression Host HEK293T
LAP3 (NM_015907) Human Tagged ORF Clone
RC209052

USD 480.00

In Stock

LAP3 (Myc-DDK-tagged)-Human leucine aminopeptidase 3 (LAP3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Aminoacylase 1 (ACY1) (NM_001198898) Human Tagged ORF Clone
RC231193

USD 98.00

USD 460.00

In Stock

ACY1 (Myc-DDK-tagged)-Human aminoacylase 1 (ACY1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Aminoacylase 1 (ACY1) (NM_001198896) Human Tagged ORF Clone
RC231170

USD 420.00

In Stock

ACY1 (Myc-DDK-tagged)-Human aminoacylase 1 (ACY1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Aminoacylase 1 (ACY1) (NM_001198897) Human Tagged ORF Clone
RC231176

USD 420.00

In Stock

ACY1 (Myc-DDK-tagged)-Human aminoacylase 1 (ACY1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Aminoacylase 1 (ACY1) (NM_000666) Human Recombinant Protein
TP301284

USD 823.00

4 Weeks

Recombinant protein of human aminoacylase 1 (ACY1)

Tag C-Myc/DDK
Expression Host HEK293T
LAP3 (NM_015907) Human Tagged ORF Clone Lentiviral Particle
RC209052L2V

USD 880.00

6 Weeks

Lenti ORF particles, LAP3 (mGFP-tagged) - Human leucine aminopeptidase 3 (LAP3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Aminoacylase 1 (ACY1) (NM_001198895) Human Tagged ORF Clone
RC234010

USD 420.00

In Stock

ACY1 (Myc-DDK tagged) - Homo sapiens aminoacylase 1 (ACY1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Aminoacylase 1 (ACY1) (NM_000666) Human Tagged ORF Clone
RG201284

USD 460.00

In Stock

ACY1 (GFP-tagged) - Human aminoacylase 1 (ACY1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LAP3 (NM_015907) Human Tagged ORF Clone
RG209052

USD 530.00

In Stock

LAP3 (GFP-tagged) - Human leucine aminopeptidase 3 (LAP3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LAP3 (NM_015907) Human Tagged ORF Clone
RC209052L3

USD 680.00

3 Weeks

Lenti ORF clone of Human leucine aminopeptidase 3 (LAP3), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LAP3 (NM_015907) Human Tagged ORF Clone
RC209052L4

USD 680.00

3 Weeks

Lenti ORF clone of Human leucine aminopeptidase 3 (LAP3), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LAP3 (NM_015907) Human Tagged ORF Clone Lentiviral Particle
RC209052L4V

USD 880.00

7 Weeks

Lenti ORF particles, LAP3 (mGFP-tagged) - Human leucine aminopeptidase 3 (LAP3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Aminoacylase 1 (ACY1) (NM_001198896) Human Tagged ORF Clone Lentiviral Particle
RC231170L3V

USD 820.00

6 Weeks

Lenti ORF particles, ACY1 (Myc-DDK tagged) - Human aminoacylase 1 (ACY1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Aminoacylase 1 (ACY1) (NM_001198897) Human Tagged ORF Clone Lentiviral Particle
RC231176L3V

USD 820.00

6 Weeks

Lenti ORF particles, ACY1 (Myc-DDK tagged) - Human aminoacylase 1 (ACY1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Aminoacylase 1 (ACY1) (NM_001198898) Human Tagged ORF Clone Lentiviral Particle
RC231193L3V

USD 820.00

6 Weeks

Lenti ORF particles, ACY1 (Myc-DDK tagged) - Human aminoacylase 1 (ACY1), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Aminoacylase 1 (ACY1) (NM_001198896) Human Tagged ORF Clone
RG231170

USD 460.00

3 Weeks

ACY1 (GFP-tagged) - Human aminoacylase 1 (ACY1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Aminoacylase 1 (ACY1) (NM_001198897) Human Tagged ORF Clone
RG231176

USD 460.00

3 Weeks

ACY1 (GFP-tagged) - Human aminoacylase 1 (ACY1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Aminoacylase 1 (ACY1) (NM_001198898) Human Tagged ORF Clone
RG231193

USD 460.00

3 Weeks

ACY1 (GFP-tagged) - Human aminoacylase 1 (ACY1), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Aminoacylase 1 (ACY1) (NM_001198895) Human Tagged ORF Clone
RG234010

USD 460.00

3 Weeks

ACY1 (GFP-tagged) - Homo sapiens aminoacylase 1 (ACY1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Aminoacylase 1 (ACY1) Capture Mouse Monoclonal Antibody [Clone ID: OTI1E5]
TA600052

USD 379.00

In Stock

ACY1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1E5

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700052
LAP3 Rabbit Polyclonal Antibody
TA345102

USD 475.00

5 Days

Rabbit Polyclonal Anti-LAP3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAP3 antibody: synthetic peptide directed towards the N terminal of human LAP3. Synthetic peptide located within the following region: LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN
LAP3 (NM_015907) Human Tagged ORF Clone
RC209052L1

USD 840.00

In Stock

Lenti ORF clone of Human leucine aminopeptidase 3 (LAP3), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Aminoacylase 1 (ACY1) Capture Mouse Monoclonal Antibody [Clone ID: OTI2B5]
TA600053

USD 379.00

In Stock

ACY1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2B5

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700051
LAP3 Rabbit Polyclonal Antibody
TA345101

USD 475.00

5 Days

Rabbit Polyclonal Anti-LAP3 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Lap3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QDLELPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKVAVSAKLHGSGD
Aminoacylase 1 (ACY1) (NM_000666) Human Tagged ORF Clone
RC201284L2

USD 620.00

3 Weeks

Lenti ORF clone of Human aminoacylase 1 (ACY1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
LAP3 (NM_015907) Human Tagged ORF Clone
RC209052L2

USD 680.00

3 Weeks

Lenti ORF clone of Human leucine aminopeptidase 3 (LAP3), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Aminoacylase 1 (ACY1) Rabbit Polyclonal Antibody
TA308034

USD 415.00

5 Days

Rabbit polyclonal antibody to Aminoacylase-1 (aminoacylase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 89 and 366 of Aminoacylase 1 (Uniprot ID#Q03154)
Aminoacylase 1 (ACY1) Mouse Monoclonal Antibody [Clone ID: AT1E2]
AM50353PU-N

USD 340.00

2 Weeks

Aminoacylase 1 (ACY1) mouse monoclonal antibody, clone AT1E2, Purified

Applications ELISA, WB
Reactivities Human